KEGG   Fusarium oxysporum: FOXG_18378Help
Entry
FOXG_18378        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
fox  Fusarium oxysporum
Pathway
fox00052  Galactose metabolism
fox00500  Starch and sucrose metabolism
fox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    FOXG_18378
   00500 Starch and sucrose metabolism
    FOXG_18378
Enzymes [BR:fox01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     FOXG_18378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Rotavirus_VP7
Motif
Other DBs
NCBI-GeneID: 28959084
NCBI-ProteinID: XP_018236327
UniProt: A0A0J9WIC3
LinkDB All DBs
Position
8
AA seq 395 aa AA seqDB search
MTISPDATHNDELNTTEYQMHNLFGNQISNATYHGLLELFPGHRPFNIARGNFAGIGRYA
TRWGGDNSSKWGSMFLSISHALTHMMAGIPMFGVDICGYSHNASFDLCARWMSLGAFMPF
YRNHNMGGTISQEAFVWSSVAEASRRAIAIRYSLLNYIYTLFYYANTKGDLVMRALAWEF
PNDESLKATYSQFLLGPSLLVTPVLTPNSKTVRGVFPGIGEGTRWYDWYTLNEVHAKPQE
NITLDAPLEHINLHIRGGTVFTLQKPGNTTAATRRNPFSLLLALDDNEYAEGSVYFDDGV
SLEPEATKTVAYTFRKGILRAETTGDYKVSPPLVNITVAGLRKAPKRVEFHSDEGKQKGL
SPKLEYSNGTAYVTELEHFTRNGAFRYDFQVTFKY
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttctccagatgcaactcacaatgatgagttgaacaccactgagtaccaaatg
cataatctgtttggcaaccagatctctaatgcgacctaccacggactgcttgagttgttc
cctggtcatcgcccattcaacatcgcccgtggcaactttgctggcattggcagatatgct
acgagatggggcggtgataactcatcaaaatggggaagcatgttcttgtccatctcacat
gctctgacgcacatgatggctggaatacctatgtttggagttgacatctgtggttactct
cacaatgctagctttgatctttgcgcccgatggatgtctctgggtgccttcatgcctttt
tatcgcaatcataatatgggtggtaccatatctcaagaggcgttcgtttggtcatctgtt
gctgaagcttcacgtcgagctatagcgataagatacagcctcctcaactacatttacaca
ctgttctactacgccaataccaaaggcgaccttgtcatgcgagctttggcatgggagttt
ccaaatgacgagagcctcaaggccacctactcccagtttttactgggtccatccctttta
gtaacacctgtgctcactccaaactccaaaacagttcgcggtgtttttcctgggattgga
gaaggaacaaggtggtatgactggtacacattgaatgaagtccatgccaaacctcaagag
aacatcactcttgatgcacctttggaacatattaatcttcacatcagaggcggcacggta
ttcacattgcaaaaaccaggaaatacaactgcagcgacaagaaggaacccgttctcactt
ctcttggctctagacgataatgagtatgctgaaggaagtgtgtattttgatgacggtgtc
agtctcgaaccagaagccaccaagactgtcgcatataccttcaggaagggaattctaagg
gcggaaaccactggtgactacaaagtcagtcctccacttgtaaacataactgttgctgga
cttcgcaaggcgcccaagagagttgagttccattctgatgaaggaaagcaaaaaggtttg
tcacccaagcttgaatacagtaacggcacggcatatgtaacagagctggaacactttaca
cggaatggggcctttagatatgactttcaggtcacattcaagtattaa

DBGET integrated database retrieval system