KEGG   Faecalibacterium prausnitzii SL3/3: FPR_20580Help
Entry
FPR_20580         CDS       T02592                                 

Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Pathway
fpa00270  Cysteine and methionine metabolism
fpa00330  Arginine and proline metabolism
fpa00480  Glutathione metabolism
fpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    FPR_20580
   00330 Arginine and proline metabolism
    FPR_20580
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FPR_20580
   00480 Glutathione metabolism
    FPR_20580
Enzymes [BR:fpa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     FPR_20580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_PK Methyltransf_25 MTS
Motif
Other DBs
NCBI-ProteinID: CBL02266
UniProt: D4KBQ3
LinkDB All DBs
Position
2095708..2096565
Genome map
AA seq 285 aa AA seqDB search
MEFWFSEFHTPDVKHSIRVNKQLYSKQSDYQRIDIFETPEFGRVLTLDGNVMLTERDEFI
YDEMIVHVPMAVHKEAKDILVIGAGDGGVVRELTRYDRVERIDLVEMDPQVVEACRAYLP
SNACRMDDRRVHIYFENALKYIRRCEEEYDLIIVDSSDPFGPSEGLFTREFYGSCFNALK
EDGIMVNQQGSPFYAEDASAMQRSHKRIASTFPISRVYQAHIPTFAAGYWLFGFASKKYH
PIDDLDAESWKALNMRTRYYTTKLHIGAFYLPAFLEEMLREVEEH
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaattttggttttcagagtttcacaccccggatgtgaagcacagcattcgtgtgaac
aagcagctctactccaagcagagcgattatcagcgcattgatatctttgagaccccggag
ttcggccgggtgctcacgctggacggcaacgtgatgctgaccgagcgcgatgagttcatc
tacgatgaaatgatcgtccatgtgcccatggcggtgcacaaggaagccaaggatattctg
gtcatcggtgccggagacggcggcgtggtgcgggagctgacccgctacgaccgtgtggag
cgcatcgaccttgtggagatggacccgcaggtggtggaggcctgccgcgcttacctaccc
agcaatgcctgccgtatggatgaccgtcgggtgcatatctattttgagaatgccttgaag
tatatccgccgctgcgaggaggagtacgaccttatcattgtggactcctccgaccccttc
ggcccctctgagggtctgttcacccgcgagttctacggcagctgcttcaacgccctgaaa
gaggacggcatcatggtcaaccagcagggcagccccttctacgccgaggacgccagcgcc
atgcagcgcagccacaagcgcattgcatccaccttccccatcagccgggtgtatcaggcg
catatccccacctttgcggcagggtactggctgttcggctttgcaagcaaaaaataccat
cccatcgatgatctggacgctgaatcgtggaaggcgctgaatatgcgcacccgctactac
accaccaaactgcatatcggagcattctacctgccggcttttctggaggagatgctgcgg
gaagtggaggaacactga

DBGET integrated database retrieval system