KEGG   Faecalibacterium prausnitzii SL3/3: FPR_30230Help
Entry
FPR_30230         CDS       T02592                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fpa  Faecalibacterium prausnitzii SL3/3
Brite
KEGG Orthology (KO) [BR:fpa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpa01001]
    FPR_30230
Enzymes [BR:fpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     FPR_30230
Protein kinases [BR:fpa01001]
 Serine/threonine kinases: Other
  Bacterial family
   FPR_30230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Seadorna_VP7 Kdo FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: CBL03104
UniProt: D4K695
LinkDB All DBs
Position
3063185..3065071
Genome map
AA seq 628 aa AA seqDB search
MDNLIGKRLDGLYEVQELIGSGGMANVYKAVMRGQNGPVPAGTVVAVKVLRREYMHDPDL
VRRFKNESKAISLLNHPNIVKVYDVSVNDHLQYIVMEYVDGMTLREYLNERGGKLSSRET
VHFISQILKALEHAHANGVVHRDIKPQNIMLLDNGQLRMMDFGIARISRADNQMLAGKAM
GSVHYISPEQAKGDETDRTSDIYSVGVMMYEMLSGHLPFDADDVVEVAIKQISDEPRSLH
ELAPEVPYALVEITEKAMAKLPQNRYPSARAMLEALDTYVQNPSVLFEYQYITEEAPEKV
VKRTMNQNRAIRQNEQPAPRKKGKGKPGKKRRTVFLPALFGITIAFALACMALCWMILND
SSNLMNNKADVTLGDYIGMTKDQAMATDQIASGQISPEWEEEYNSNYAAGYIYKQSPVSG
RTVREGQSVTLTVSLGTQYVTVPDLTNYVQTDAEQQLKALGVSVLVTQAVDTSVASGAVI
RTDPAAGTQVAAGSTVILYISRPQVSTTTKVPSLTGMSVDDARTLLVQNHLGLGSQSEEY
SDQPAGTVLSQNPAAGTTAKLNSRVNVVVSAGAAPVQEPEQPGGDGTTSGTTGEGSTGGE
STGGSSEPSSSSSSTGGGILDWWSSLLG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggataacctgatcggtaaaagactggacggtctgtacgaggtgcaggagctgatcggc
tccggcggcatggccaacgtgtataaggcggtcatgcggggacagaacggccctgtgccc
gccgggactgtggtggccgtcaaggtgctgcggcgggagtatatgcacgacccggatctt
gtgcgccgctttaaaaacgaatccaaggccatctcactgctgaatcaccccaatatcgtt
aaggtgtacgatgtctcggtcaacgaccatctgcagtatattgttatggaatatgtggac
ggcatgaccctgcgggagtacctcaacgagcggggcggcaagctttccagccgggagacc
gtgcacttcatctcccagatcctcaaggcgctggagcatgcccacgccaacggcgtcgtg
caccgggatatcaagccccagaatattatgctgctggataacggccagctgcgcatgatg
gacttcggtatcgcccgcatttcccgggcagataaccagatgctggccggcaaggcaatg
ggcagcgtgcattatatcagcccggagcaggccaagggagacgagaccgaccgcaccagc
gacatctactctgtgggcgtcatgatgtacgagatgctttccggacatctgccctttgat
gccgatgacgtggttgaggttgccatcaagcagatctcggacgagccccgctcgctgcac
gaactggcaccggaagtgccctatgcgctggtggagatcaccgaaaaggctatggcaaag
ctcccccagaaccgctacccctcggcacgggcgatgctggaagcactggacacctatgtg
cagaacccctccgtgctgtttgaatatcagtatattacagaagaagcgcccgaaaaggtg
gtgaaacgtaccatgaaccagaaccgcgcgatccgtcagaacgaacagcccgcaccccgc
aaaaaaggcaagggaaaaccgggcaaaaaacgccgcactgtctttttgccggccttgttc
ggcatcaccattgcctttgcactggcctgcatggcactgtgctggatgattctgaacgac
tcctccaacctgatgaacaacaaggccgatgtcacccttggagactatatcggcatgacc
aaggatcaggccatggctacggatcagatcgcatccggccagatctccccagagtgggaa
gaggagtataacagcaactatgcggccggttatatctataagcagtcgccggtgtccggc
cgcaccgtccgcgagggtcagagcgtgactttgaccgttagtcttggcacccagtatgtc
accgtgccggacctgaccaactatgtgcagaccgatgccgaacagcagctcaaggcactg
ggcgtttcggtgctggtcacgcaggctgtggatacctcggtggcctccggtgcggtcatc
cgcaccgaccctgccgccggtacgcaggtggcggcaggctctacggtcatcctctatatc
agtcgtccgcaggtgtccaccaccaccaaggtgccctcgcttaccggcatgagcgtggat
gatgcccgcaccctgctggtgcagaaccatctggggcttggcagccagagtgaagaatac
agcgaccagcccgcaggtacggtgctcagccagaaccctgcggcaggtactaccgcaaaa
ctgaacagccgcgtaaacgttgtggtcagcgcgggcgctgcaccggtacaggaaccggag
cagccgggtggcgatggcactacttccggcaccacgggcgaaggttctaccggcggtgag
agcaccggcggcagcagcgagccgagctccagcagcagctccacaggcggcggtattctg
gactggtggtcctcgctgttgggctga

DBGET integrated database retrieval system