KEGG   Flavobacterium psychrophilum CSF259-93: FPSM_01462Help
Entry
FPSM_01462        CDS       T03254                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fpc  Flavobacterium psychrophilum CSF259-93
Pathway
fpc00240  Pyrimidine metabolism
fpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FPSM_01462
Enzymes [BR:fpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FPSM_01462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AIJ37957
UniProt: A0A076P3W9
LinkDB All DBs
Position
1619916..1620524
Genome map
AA seq 202 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPTIDTRYDDEM
VVSHNKNEIRSTPVPAAANIAILAQGCDVVGIDEAQFFDDEIVKICNDLANSGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKTDNDKLVMLGETEEYEP
LSRAAYYNAMRENMIVKDAEHL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagagcagtttggttggattgaagttatttgc
ggatcgatgttttcgggtaaaaccgaggagttaattcgtagattaaaaagagcacaattt
gccaaacaaaaagtcgaaatttttaaacccactatcgataccagatatgatgacgaaatg
gtggtttcgcataacaaaaacgagattagatctacgcctgttcccgcagctgcaaacatt
gcaattttagcccaaggttgcgatgttgttgggattgatgaggcgcaattttttgatgac
gagattgtaaaaatttgtaatgaccttgccaattcaggcattagagttattgtggctgga
ttggatatggattttaaaggaaatccttttggccccatgccagcacttatggcaacggca
gaatatgttacaaaagtacacgccgtttgtacccgtacaggaaatttggccaattatagt
tttcgcaaaaccgataatgacaaactcgttatgcttggcgaaaccgaagaatacgaaccc
ttaagtcgtgccgcatattataatgccatgagagaaaatatgattgtaaaagatgctgaa
catttataa

DBGET integrated database retrieval system