KEGG   Flavobacterium psychrophilum CSF259-93: FPSM_01463Help
Entry
FPSM_01463        CDS       T03254                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fpc  Flavobacterium psychrophilum CSF259-93
Pathway
fpc00473  D-Alanine metabolism
fpc01100  Metabolic pathways
fpc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fpc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FPSM_01463
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    FPSM_01463
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fpc01011]
    FPSM_01463
Enzymes [BR:fpc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     FPSM_01463
Peptidoglycan biosynthesis and degradation proteins [BR:fpc01011]
 Precursor biosynthesis
  Racemase
   FPSM_01463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AIJ37958
UniProt: A0A076NWF4
LinkDB All DBs
Position
1620534..1622987
Genome map
AA seq 817 aa AA seqDB search
MDPLTISLHNIIPILDANFQGIDENIYYDTISIDSRSLQNNENTLFFALVGPNNDAHIYI
GDLISKGVKNFVVTYIPKRLTGKANFLIVKNTLVALQIFARYYRNLFHFPIIGITGSNGK
TIVKEWLNFLLSPDYNIIRSPKSYNSQVGVPLSVIAINENHNLGIFEAGISTKDEMENLQ
KIIQPTIGILTNIGTAHDEGFADISEKIKEKLKLFTAVEVLILNKNKTIETFINKEINTF
TWSTNDQSADVFFQKKTLNDHALLNITNQGKYFKIKIPFIDEASLENSMHCILVMLYLKY
DLDTIKHRISQLFPVEMRLKVKNGINNCTLIDDSYSSDFQSLKIALDFLENQKQHLKKTL
ILSDIYQSGLENEDLYVRVSQLIISNKINRVICIGGVISKYKNKFLNVISYLSTNDFIED
FDNLDFTNETILIKGSRHFEFEKIVTLLEEKTHETVLEINLNAISHNLNYFKSKLNPKTK
IMVMVKAFGYGSGSFEIAKLLAHHKVNYLGVAFADEGIELRQAGIQLPIMVLNPEMTSFP
SIIQYNLEPEIYSIRGLKAFIKITQQKELTSYPIHIKINTGMNRLGFDAQIIPELISILQ
KHDSVLVKSILSHLAASDDLAQDIFTRKQISDFDTISNKITTKLKINPIRHISNTSAISN
YPQAQFDMVRLGIGLYGVSNDANETKKLENVGTLKSIISQIRNLNSGQSVGYNRRFMVKK
PTTIATIPIGYADGISRAWGNEVGYVLVNEQKAPIVGSICMDMLMIDVTKINCSEGNQVI
IFGKTPSVTTIAKATKTIPYEILTSISSRVKRVFYRE
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
ttggacccattgactatatccttacacaatataattcctattctagatgccaattttcag
ggtattgacgaaaatatttactacgatactatctcgatagatagtcgttcgcttcaaaac
aacgaaaacactttgttttttgcactagttggtcctaataatgatgcccatatttatatt
ggagatttaatctccaaaggtgttaaaaactttgtagttacctatattcctaaaagatta
actggcaaagcaaattttttaattgtaaaaaacactcttgtagctttacaaatatttgcc
cgttattatcgtaatttatttcattttccaatcataggaattacaggaagcaacggaaaa
accattgtaaaagaatggcttaatttcttattaagtcctgattataatataattagaagt
cctaaaagctacaattcgcaagttggcgttcccctttctgtgattgcaattaatgaaaat
cataatttaggcatttttgaagccggaatttctaccaaagacgaaatggaaaatcttcaa
aaaataatacagccaaccattgggattttaaccaatatagggaccgctcatgatgaaggt
tttgctgatatttctgagaaaataaaagaaaaactcaagctatttactgccgtagaagtt
ttaattcttaataagaataaaaccatcgaaacttttattaacaaagagattaatactttt
acttggagtacaaatgatcagtctgccgatgttttttttcagaaaaaaacactcaatgat
catgctcttttgaatattacaaatcaggggaaatattttaaaataaaaattccatttatt
gatgaagcttcactagaaaacagcatgcattgcattttggtaatgttatatttgaagtat
gatttagatacaattaagcatcgtatttctcaattatttccagtcgaaatgcgattgaag
gtaaaaaacggaattaacaattgtactttaattgatgatagttatagttctgattttcag
tctttaaaaatagctttagattttcttgaaaatcaaaaacaacacttaaaaaaaacactc
attttatcagatatttatcagtcaggattagaaaacgaagacttatatgttcgtgtttct
cagcttattatttcaaacaaaataaatcgagtaatttgcattggaggtgtaatttctaaa
tataaaaacaagtttctcaatgtcatttcttacctttcaacaaatgattttattgaagat
tttgacaatctagattttacaaacgaaactattttaataaaaggatctcgacatttcgaa
ttcgaaaaaattgtaaccttactcgaggaaaaaacacatgaaacagttttagaaattaac
cttaatgccataagccataatttaaattacttcaaatcgaaactaaatcccaaaaccaaa
atcatggttatggtaaaagcttttggttacggaagtggctcatttgagattgccaaactc
ctcgcccaccacaaagtaaattatcttggtgtggcattcgccgatgaaggaatcgaactc
cgccaagcaggcattcaattacctatcatggttctaaatccagaaatgaccagtttccca
tcgataattcaatacaatttagaacccgaaatatatagtattcgaggtctgaaagcattt
ataaaaattacccaacaaaaagaacttaccagttatcctatacatattaagataaataca
ggtatgaatcgtttgggttttgatgcgcaaattattccagaactcatctcaatattacaa
aagcatgattcagttttggtaaaaagtattttgtctcatttagcggcaagcgatgattta
gcacaggatatttttacccgaaaacaaatttcagattttgatacaatatctaataaaatt
accacaaaattaaaaataaaccctattcgccatatttcaaacacctctgcaataagcaat
tatccgcaagcgcagtttgatatggttcgattaggcattgggttatatggcgtttctaat
gatgccaatgaaacaaaaaaacttgaaaatgtagggacactaaaatcgataatttcacaa
attcgcaatttaaacagtggccaaagcgtagggtataatagaaggtttatggtaaaaaaa
cctaccacaattgctacaatcccaataggctatgccgacggaatttcacgtgcttgggga
aatgaagttggttatgttttagttaatgaacaaaaagcccccatagtaggaagtatttgt
atggatatgctaatgatagatgtcacaaaaattaattgttctgaaggtaatcaagtaatt
atctttggcaagaccccatcagtaaccaccatcgcaaaagcaacaaaaacaataccttac
gaaatattaacaagtatttcaagcagggtaaaacgggttttttacagagaataa

DBGET integrated database retrieval system