KEGG   Flavobacterium psychrophilum CSF259-93: FPSM_01589Help
Entry
FPSM_01589        CDS       T03254                                 

Definition
(GenBank) 23S rRNA (guanine(2445)-N(2))-methyltransferase
  KO
K07444  putative N6-adenine-specific DNA methylase [EC:2.1.1.-]
Organism
fpc  Flavobacterium psychrophilum CSF259-93
Brite
KEGG Orthology (KO) [BR:fpc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FPSM_01589
Enzymes [BR:fpc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     FPSM_01589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 THUMP Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AIJ38084
UniProt: A0A076NTU7
LinkDB All DBs
Position
complement(1766644..1767816)
Genome map
AA seq 390 aa AA seqDB search
MENFKMIAKTFFGFEEILAKELTQLGAQDVEMGTRMVSFAGDKGFMYKANLSLRTALKIL
KPIYYFRAKSDENLYKNMQGIDWSKYLNTNQTFVIDTTVHSDYFKHSQFVSQKCKDAIVD
QFRAKTGIRPSVDKNFPDLRINIHIDKDQVSVALDTSGASLHQRGYKTATNIAPINEVLA
AGMLLLSGWEGQGHFIDPMCGSGTILAEAAMIACNIPANINRKEFAFEKWNDWDNELFDN
IMNSLLKKIKEFHYTIIGHDKAPSAVQKAIANIKNANLDEYVTISEQNFFNTEKNTEGKL
HMVFNPPYGERLDIEMERFYREIGDTLKQSYPNTNAWFITANLEALKFVGLKPSRKIKLF
NGSLEARLVKYEMYEGSKRTKFQISESNDL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttaaaatgattgccaaaactttttttggtttcgaagaaatattagcaaaa
gagttaacccaattaggtgctcaagatgtagaaatgggtactagaatggtaagttttgct
ggggataagggttttatgtataaagccaatttgtcgttgcgaacggcactaaaaatccta
aaacctatctattattttagagcaaaaagtgacgaaaatttatacaaaaatatgcaagga
atagattggtcgaaatatttaaacaccaatcagacttttgtgatagatacaacggtgcat
tccgattattttaagcattcgcaatttgtatctcagaaatgtaaagatgcgattgtagat
cagtttagagcaaaaacgggtattcgtcctagtgtagataaaaattttccagatttgaga
atcaatattcacatagataaagaccaagtttctgtggctttagatacttctggcgcttca
ttgcaccaacgtggttataaaacagcaaccaatattgctcctataaatgaggttttagca
gccggaatgttgttgctttctggttgggaaggtcaaggacattttatagatcctatgtgt
ggttcgggaactattcttgccgaagccgctatgattgcttgcaatattcctgccaacatc
aatcgtaaggaatttgctttcgaaaaatggaacgattgggataatgaattgttcgataat
attatgaattcgttactaaagaaaattaaagaatttcattatacaattataggtcacgat
aaagcgccaagtgccgttcagaaagcgattgccaatataaaaaatgctaatctagatgaa
tatgttaccatttctgagcaaaatttctttaacacagaaaaaaatacagaagggaagttg
cacatggtttttaatccaccttatggtgaacgattagatatcgaaatggaacgtttttac
agagaaattggcgatactttaaaacaaagttatcccaataccaatgcttggtttattacc
gcaaatctggaagcattaaagtttgtaggattaaagccttcacgaaaaattaaacttttt
aacggaagtttagaagctcgattggtaaaatacgaaatgtatgaaggaagtaagagaacg
aagtttcagatttcagagagtaacgatttgtaa

DBGET integrated database retrieval system