KEGG   Flavobacterium psychrophilum CSF259-93: FPSM_02450Help
Entry
FPSM_02450        CDS       T03254                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fpc  Flavobacterium psychrophilum CSF259-93
Pathway
fpc00010  Glycolysis / Gluconeogenesis
fpc00053  Ascorbate and aldarate metabolism
fpc00071  Fatty acid degradation
fpc00280  Valine, leucine and isoleucine degradation
fpc00310  Lysine degradation
fpc00330  Arginine and proline metabolism
fpc00340  Histidine metabolism
fpc00380  Tryptophan metabolism
fpc00410  beta-Alanine metabolism
fpc00561  Glycerolipid metabolism
fpc00620  Pyruvate metabolism
fpc00625  Chloroalkane and chloroalkene degradation
fpc01100  Metabolic pathways
fpc01110  Biosynthesis of secondary metabolites
fpc01120  Microbial metabolism in diverse environments
fpc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FPSM_02450
   00053 Ascorbate and aldarate metabolism
    FPSM_02450
   00620 Pyruvate metabolism
    FPSM_02450
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FPSM_02450
   00561 Glycerolipid metabolism
    FPSM_02450
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FPSM_02450
   00310 Lysine degradation
    FPSM_02450
   00330 Arginine and proline metabolism
    FPSM_02450
   00340 Histidine metabolism
    FPSM_02450
   00380 Tryptophan metabolism
    FPSM_02450
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FPSM_02450
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FPSM_02450
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FPSM_02450
Enzymes [BR:fpc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     FPSM_02450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIJ38945
UniProt: A0A076P5I7
LinkDB All DBs
Position
2701915..2703468
Genome map
AA seq 517 aa AA seqDB search
MATIAEQFGMTEALAQLGIKAVNEGTSTGSQWFSNGELLESYSPVDGLLIGKVKATTAAD
YERVMQSATQAFKSFRAMPAPQRGEIVRQFGNKLRELKEPLGKLVSYEMGKSLQEGYGEV
QEMIDICDFAVGLSRQLNGQTIPSERPGHVMREQWHSIGVVGIISAFNFPVAVWAWNTAL
AWICGDVCVWKASEKAPLCSVACQNIIADILKANNLPEGISCIINGDYKVGEMMTTDVRI
PLISATGSTRMGRIVGSTVAQRFGKSLLELGGNNAIIITPTADLKVVVPGAVFGAVGTAG
QRCTSTRRLIIHESVYDKVRDAIVGAYGQLTIGNPLDQKNHIGPLIDKESVSTYLAAIEA
AKAEGGKVLVEGGVLQGLGYESGCYVKPAIIEAENTYKIVQHETFAPILYLMKYSGEVEN
AIEVQNGVAQGLSSAIMTNSMKEAEKFLSFSGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKVYMRRQTNTVNYSDELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaatagcagaacaattcggcatgaccgaagcattagcacaattaggtataaaa
gcagtaaacgaaggaacttcaacaggaagccaatggttttctaacggagaattactagaa
agctattcaccagtagatggtctattaatagggaaagtaaaagcaactaccgctgccgat
tacgaaagagtaatgcaaagcgcaacccaagcctttaaaagctttagagctatgcctgca
ccacaaagaggggaaattgttcgccaatttggaaataaattaagagaattaaaagaaccc
cttggtaagttagtttcttacgaaatgggtaaatctttgcaagaaggatatggtgaagtt
caagaaatgatagatatctgcgattttgcagtaggtttatctcgacaattaaacggacaa
acaattccttcagaacgtccaggtcatgttatgagagaacaatggcattctattggtgtc
gtaggaattatttctgcctttaattttccagtagctgtttgggcttggaacaccgcttta
gcttggatttgtggagatgtatgcgtttggaaagcttcagaaaaagcgccattgtgttct
gtggcttgccaaaacattattgccgacatattaaaagcaaataatttacccgaaggtatt
tcatgtattattaatggcgattataaagtaggcgaaatgatgactaccgatgtaagaatc
ccattaatttctgcaacaggatctactcgtatgggaagaattgttggttcgacagtagca
caacgttttggtaaatctttactagaattaggaggaaataatgccattattattacacct
actgccgatttgaaagtggttgttccaggagcagtatttggtgctgtgggaactgctgga
caaagatgtacttctacaagaagattaattattcatgaatctgtttacgataaagtaaga
gatgctatcgtgggtgcttatgggcagctaacgattggcaatcctttagatcaaaaaaat
catattggcccgttaatcgataaagaatctgtaagcacttatttagctgccattgaagct
gcaaaagcagaaggcggaaaagtattagttgaaggtggagttttacaaggtcttggttac
gaatctggttgttatgtaaaaccagccattatcgaagccgaaaatacttacaaaattgta
caacacgaaacgtttgctcctattttatatttaatgaaatatagtggtgaagttgaaaat
gcaatcgaagtacaaaacggagttgcccaaggattgtcttcggcaattatgaccaatagt
atgaaagaagcagaaaaattcttatcgttctctggttcagattgcggtattgctaatgta
aacattggaacttctggtgcagaaattgggggtgcttttggtggagaaaaagaaactggt
ggcgggcgtgagtctggctctgatgcttggaaagtttacatgagaagacaaacaaacaca
gttaactattctgacgaattacctttagcacaaggaattaaatttgacttgtag

DBGET integrated database retrieval system