KEGG   Fervidobacterium pennivorans: Ferpe_1637Help
Entry
Ferpe_1637        CDS       T01808                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
fpe  Fervidobacterium pennivorans
Pathway
fpe00260  Glycine, serine and threonine metabolism
fpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ferpe_1637
Enzymes [BR:fpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Ferpe_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AdoHcyase_NAD ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 2-Hacid_dh_C NAD_binding_7 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AFG35695
UniProt: H9UDV2
LinkDB All DBs
Position
complement(1687577..1688641)
Genome map
AA seq 354 aa AA seqDB search
MGTETTNGTMKAIMKKVAGPGLVMEQVKKPTQEDLGPRDVLVKIRRASICGTDVHIYKWD
EWSQSRIIPPLITGHEMAGEVVAVGNAVTQVKVGDLVAAETHIPCEHCYQCKTGRMHICK
NLKILGVDTNGIFAEYAIIPETVLWRFSPEIPLDYASVMEPFGNAIHTASVTNLLGKTVL
ITGAGPIGLMAIQVAKVAGASTVIVSEVDPLRIRMAQENGADVVINPAEKDLVREVYKLL
GDGVDVLLEMSGNRKAFEDGLKCVTMGGEVSVLGIFGGKIEINFDALITMRGLTVYGITG
RRMFETWRIADELLRTKKVDLSKVVTHILPFDQWEKGFELMLNKQCGKVVLNLD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
ttgggaacagagacaacgaatggaacaatgaaagcgataatgaaaaaggtggcaggtcct
ggattagtaatggagcaagttaagaaacctacacaagaagaccttggaccgagggacgtg
cttgttaagataagacgagcttcaatctgtggaacggatgttcacatatacaagtgggat
gaatggtcacagtcacgtataattcctccattaatcacgggacatgagatggcaggtgaa
gttgttgcggttggtaacgcggttacgcaagtcaaagttggagacttggtagcagccgag
acacatattccttgtgaacattgttatcaatgtaaaaccggtaggatgcacatatgtaag
aatcttaagattttgggtgtcgatacaaacggtatatttgcagaatacgcgattatacct
gaaacggtcctttggagattctctcctgagatacctcttgactacgcttccgttatggaa
ccattcggaaatgcgatccatactgcctctgttacaaacttacttggtaaaacagtactt
ataaccggtgcgggacctatcggcttaatggctatccaggtcgcaaaagttgccggagca
agtacagtaatcgtttcggaagtcgacccattaagaattcgtatggctcaggaaaatggt
gcagatgttgtcatcaatcctgctgagaaagatttagtcagggaagtttacaaacttctt
ggtgatggtgtggacgttttgctcgaaatgagtggtaacagaaaggcatttgaagatgga
ctgaaatgtgttaccatgggtggagaagtatccgtacttggaatatttggtgggaagata
gaaataaactttgatgctttaattacaatgcgaggactaactgtctacggtataacaggt
agacgcatgttcgaaacttggagaattgcggacgaattgctccgaacaaagaaggttgac
ctttcaaaagtagttacccatattctcccatttgatcagtgggaaaaaggtttcgaactt
atgttaaataagcaatgtggtaaagttgttttgaatttagactga

DBGET integrated database retrieval system