KEGG   Francisella persica: ACH24_00150Help
Entry
ACH24_00150       CDS       T04357                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fper  Francisella persica
Pathway
fper00564  Glycerophospholipid metabolism
fper01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fper00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACH24_00150
Enzymes [BR:fper01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ACH24_00150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA FAD_oxidored HI0933_like Pyr_redox_3 FAD_binding_3 Pyr_redox_2 NAD_binding_8 IPPT Beta_elim_lyase Thi4
Motif
Other DBs
NCBI-ProteinID: ALB01255
UniProt: A0A0K2JPW8
LinkDB All DBs
Position
38814..40346
Genome map
AA seq 510 aa AA seqDB search
MYNNYDIIIIGGGATGFGCAIEAVSRGYQTLLLESSDFGKGTSSKSTKLIHGGLRYLENF
DFALVKEGLEERFSFLRNAPHLTHKQSYLIPMCSCFETIKYTIGVKLYEFLSGKYKIGKS
YNLNKQQTLKELPNIDAAKLKKSLVYYDGQFDDTRLLISLMKTFEANGGTALNYHQVEKI
YSSTNSKLDTVKVIDVLNGEYKEFIAKHIINATGTFSDKTISLASQQDAHNYVSVAQGTH
IVFARDKFPTKHAILIPETNDGRVLFILPWHNHLIVGTTDIKKEAPSLEPKADKSEIDFI
LETFNQYAKDKATIADIKSVYCGQRPLLAPRKAKNSAKISRKHEIFESKDGLITVVGGKW
TIFRRMGQDTIDYIETKKIALKPSKTSDQLLIDAIEPKESYPLKVYGKNAEDIKNIQNEL
NNFELLARGLPYYQAEVIYHVRHEKAKTVEDVLARRTRAAFLDIKASIDAAPIVAELMAK
ELGKDQAWQNQQIESFIEFSKNFNVEELYK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtacaataattatgatattataataattggtggtggcgcaactggctttggttgtgct
attgaggcggtttctcgaggttaccaaactctacttctagaatcgagtgattttggtaaa
ggaacctcttcgaagtcaacaaaattgattcatggtggtttaagatatttagagaatttt
gactttgctttagttaaagaaggtcttgaagagagattctcttttttacgtaatgcgcca
catctgacacataaacaatcttatcttattccaatgtgtagctgttttgagactattaaa
tatactattggtgttaagctctatgagtttttatcaggtaaatataagattggcaaaagt
tataatctaaataaacaacaaacacttaaagagctccctaatatagatgccgcaaaacta
aaaaaaagcttagtttattatgatggacagtttgatgatactcgccttttgatctctttg
atgaaaacttttgaggcaaatggtggtacagcgcttaattatcatcaagttgaaaaaata
tatagctcaactaattcaaaattagatactgttaaggttattgatgttttaaacggtgaa
tataaagaattcatagctaaacatataatcaatgctacaggtacatttagtgataaaact
ataagtctggcaagtcagcaagatgcacataactatgtttctgtcgcacagggaactcat
attgtttttgctagggataagtttccaactaaacatgcgattttgatacctgagactaat
gatggtcgcgtattgtttatcttgccatggcataatcacctaatagttggtactactgat
attaaaaaagaagcaccaagtcttgagccgaaagctgataaatcggagatagactttata
ttagagactttcaaccaatatgctaaagacaaagcaactattgcagatattaagtcagtt
tactgtggccagcgtcctttattagctccaagaaaagctaaaaattctgcgaaaatatcg
cgtaagcatgaaatttttgagtcaaaagatggcttaattacagttgttggaggtaagtgg
actatttttagaagaatgggtcaagatactattgattatattgaaactaagaaaattgcg
ctaaaaccctcgaaaacttcagaccaattacttattgacgctatcgaacctaaagaaagt
tatccactaaaagtttatggcaaaaatgctgaagatatcaaaaatattcaaaatgagctt
aataattttgaacttttagctagaggtttgccatactatcaagcagaggttatatatcac
gttagacatgaaaaagctaaaactgttgaagatgtccttgcacgtcgaactagagcagca
tttttggatatcaaagcaagtattgatgctgcgccaatagtagctgagcttatggcaaaa
gagcttggtaaagatcaagcttggcaaaaccagcaaattgaaagtttcatagagttttct
aaaaactttaatgttgaagagttgtataagtag

DBGET integrated database retrieval system