KEGG   Fabibacter pacificus: DCC35_13095Help
Entry
DCC35_13095       CDS       T05953                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
fpf  Fabibacter pacificus
Pathway
fpf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:fpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DCC35_13095
Enzymes [BR:fpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DCC35_13095
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DCC35_13095
    1.1.1.-  
     DCC35_13095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N ADH_N_assoc AviRa TrkA_N Methyltransf_25 adh_short
Motif
Other DBs
NCBI-ProteinID: QCK15614
UniProt: A0A4D7K474
LinkDB All DBs
Position
2974418..2975503
Genome map
AA seq 361 aa AA seqDB search
MLKLYSTPPGDQVSIINNQNFKSMNNSNPSGVFHGVHDIRVDEKEAPVINENSIIVKVEM
TGICGTDLHIYHEGLVPEGSVLGHEFCGEIIEKGSKVKDLNVGERVVINPMENGIGLGVS
PGGFARYVKIDNAEKNTNTFSIPDSVNSEKGALIEPFSVGLAAINKTNLTKEDSVLVTGC
GTIGLVTIAGLKSKGIKNIIASDISDKRLELAKQLGANYTFNPSSDDKLDDLIINNFGTV
NSLNYAGELPNLNAAFECSGVGAVFSQSVNLLAPDGSLTILAIYSKELSLDPNLVVYKRL
NILGSLFYTPNDFIEAIDLMASGEVDLSPIVSHHFPLDELPKAFETQADSRKSVKVIVDS
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgcttaaattatatagtaccccacctggcgaccaggtaagtattattaataatcaaaat
tttaaaagcatgaataattcaaatccctccggagtatttcatggcgtacacgatattcgc
gtggatgaaaaagaagcaccagtcataaatgaaaacagtattatcgtaaaagtagaaatg
actggtatctgtggaaccgacctgcatatttatcatgaaggactggtacccgaaggatca
gttttaggacatgaattttgtggagaaataatagaaaaaggaagtaaagtcaaggatttg
aacgtcggtgaaagagtagtcataaatccgatggaaaatggaattggtctcggagttagt
ccgggagggtttgccaggtatgtcaaaatcgataatgctgaaaaaaatacaaacactttc
tctatacccgatagcgtcaacagtgagaaaggagctttaatagaacccttttccgttgga
ttggcagctatcaataaaacaaatctgacaaaagaagattcagttttagttaccggctgt
ggtaccatcggacttgtgactattgcaggtcttaaaagtaaaggaataaaaaatattatc
gcttcagatattagtgataaacgattggaattagctaagcaactgggcgctaattacacc
ttcaatccctcctctgatgacaaacttgatgacttaataataaataattttggcacagtt
aattctctcaattatgctggagaactccccaacctcaatgcagccttcgaatgctctggc
gttggagcagtttttagtcaatcagttaatctattagcaccagatggatccttaacaatt
ctggctatttatagcaaagaattatctctagatccaaaccttgtcgtttacaaacggcta
aacattctgggatcattgttttatactccaaatgattttatagaggcaatagatctaatg
gcatcaggcgaggtggacctgagtccgattgtttctcatcatttcccattagatgagcta
cctaaagcttttgaaacacaagcggatagcagaaaatcggtaaaggtgattgttgacagc
atctag

DBGET integrated database retrieval system