KEGG   Falco peregrinus (peregrine falcon): 101910491
Entry
101910491         CDS       T02856                                 

Gene name
EVC
Definition
(RefSeq) EvC ciliary complex subunit 1
  KO
K19605  ellis van creveld syndrome protein 1
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101910491 (EVC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fpg03036]
    101910491 (EVC)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    101910491 (EVC)
SSDB
Other DBs
NCBI-GeneID: 101910491
NCBI-ProteinID: XP_005243153
LinkDB
Position
Un
AA seq 927 aa
MNKDDSQRLLESFNSDDREHTLAKIKAEPYTSKEEMVLEESECPLNSNITAFALKAKVIY
PINQKFRPLADGSSNPSLHENPKQAVLPNQVMETSTSGSLGSLSQGDKEDCSSSTTIHST
TSDDRFQARAFLKVTSFPEVLTCESFDVKLCLCSLILKDLMLLDTELRKEKHVMFVQVLK
IYLTDFYHKKKITDDLFKKILLNQKNDFEELQKQLHSRLQNTEVSGAHNSEYQTVEDLER
KEREYSEHVIDNMETFWKQTDKAQQAFLDQTKCSSAKATKIMMDLTEKMIAVESLLSESQ
DLQAMDIQERLFSWELMVKMVDSLKSYIPEECKCRLNIVSNILDHLTVKNNLSVRQKEEL
LTDLHKAFWEQLAHFSNECMQQSKDMILKQLECRAKKREELKNRHKAEQGSLLSKTFHNE
DVHDFLKAYHELLEKHRQAQWELEEEDDFKSTEAVADLYKELYYKASHALAELVTELFLQ
ILPVVTGLSVRECELLKEEWQENLVPLEKWETHHQRRWKLFQEQLLQEKKLWIKEYALSA
VMQKHLSEKQEKIIQGVVSRLGCLSDESVNYILQKHRLLLCSVLRRLTLRRVGMAALACM
RLSRKKSLLQELREQHALQKGSYPCQDEDQWQLQKAVESHILEEEEKLEEETQQIHLEFH
QQLVTEIQEALQFLQQHMEQVIGQTLLQHARREAGKKSSNDGQDFKERLVEAAVESVYGT
SDNINRLVQNYYQQLGKITEGYEGKKLQQLKSLRAERGERNRVKKKQENEXXXXXXXXXX
XNVSSTVHQRTVLQQQKVLAQFELQQQIRLKSLKQKLLELHHLETELENQLREAEQDFVS
ELAVLTRVPVAVKKQPSKRSKPAGEKTNSERKTFQSPESADKDDSHENIQELPRLTSGLC
RDRLQSPHKGETELRKNSKLLKKRANR
NT seq 2784 nt   +upstreamnt  +downstreamnt
atgaataaggatgattcccagagacttttggaaagcttcaactctgatgacagagagcac
acgctcgcaaaaattaaagcagaaccctatacatcaaaagaggaaatggtgctggaggaa
agtgagtgtcctctgaacagtaacatcacagcatttgcattaaaggcaaaagtgatctat
cccatcaatcagaaatttaggcctttggcagatggctcatccaatccatctttgcatgag
aatccaaagcaggcggttctgcctaatcaggtcatggagacatctacctcaggcagcctg
ggatccctgagccagggagacaaagaggactgcagctcctctacaacaatacattccaca
acaagcgatgacagatttcaggctcgagccttcctcaaggtgaccagcttccctgaagtg
ctaacatgtgagagttttgatgttaagctctgcctttgcagtcttattttaaaagatctc
atgcttcttgatactgaactcagaaaagaaaaacatgtgatgtttgttcaggttctcaaa
atatacctcacagacttttatcataaaaagaagattactgatgatttgttcaagaagatc
ctcttaaatcagaaaaatgattttgaagaattacagaagcagcttcactctagactccag
aatactgaggtgtcaggagcccataattcagagtaccagactgtagaagacttagaaagg
aaagaaagggaatattctgagcacgtaatagataatatggaaactttctggaagcagact
gacaaagcccagcaggcttttttggaccaaacaaaatgctcaagtgccaaagcaacaaag
ataatgatggatctgactgagaagatgattgcagtagaaagcttattaagtgaatctcaa
gatttgcaggcaatggacattcaggaaaggttattcagctgggagcttatggtgaaaatg
gttgattcactgaagtcctatataccagaagagtgcaagtgtagattaaatattgtatca
aatattctagaccatttaactgtaaagaataatctctctgtccgacaaaaagaagaactt
ttaacagatctgcacaaggccttctgggaacagctggcgcatttcagtaatgaatgtatg
cagcaaagtaaagacatgatcttgaaacaactggagtgccgtgcaaagaagagagaagag
ctcaaaaacagacacaaagctgaacaggggagtctcctcagtaaaacttttcataatgaa
gatgttcatgattttcttaaggcttaccatgagctgctagagaagcatcgacaagcacag
tgggaactggaggaggaggatgacttcaagagcactgaggctgttgcagatctctacaag
gaactgtactataaagcttcccatgctttagcagagttggtgacagagctgtttcttcag
atcctgcctgttgtgaccggcctctctgtaagagaatgtgagcttctgaaagaggaatgg
caggagaatttggtccctctggagaaatgggagacccaccaccagagacgctggaagctt
ttccaggagcagctattgcaagaaaaaaaactatggataaaggaatatgctctgtctgct
gtgatgcaaaagcacctgtctgagaaacaagagaagataattcaaggtgtcgtaagcaga
ctagggtgcctcagtgatgagtctgttaactatatattgcaaaaacatcggcttctgctg
tgttcagtactcagaaggttaaccctccgaagagttggaatggcagccctggcctgcatg
agactgtccagaaagaagagcttgcttcaggaactgagagaacaacatgccctgcagaag
ggatcctacccctgccaagatgaggaccagtggcagttacaaaaggcagtggagtcccac
attctggaagaggaggagaagctcgaggaagaaacacagcaaatccatttagaatttcac
cagcagctagtcacagaaatccaagaagctcttcagtttcttcagcagcatatggagcag
gtgattgggcagacactgctgcagcatgcgcgaagggaagctggaaaaaagagttcaaat
gatggacaggactttaaggagagactggtagaagctgctgtagaaagtgtgtatgggacc
agcgataatatcaatagactggtgcaaaactactatcaacagttaggaaaaatcacagaa
ggctatgaagggaaaaagcttcaacaactgaaatccttacgagcagaaagaggggaaagg
aacagagttaagaagaaacaagagaatgaannnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nngaacgtatcatccacagtccatcaaaggactgtgctgcagcagcagaaggttttggct
cagtttgaactgcagcagcaaattcgtctgaagtctctgaaacagaagctgctggaattg
catcacctagaaactgagttggagaatcagctaagggaagcagagcaggactttgtgagt
gagttggctgtgctgacccgagttccagtggctgtgaagaagcagccttccaaaaggagc
aagccagcaggggaaaaaacaaactcggaaaggaagacctttcagtcaccagaatcagca
gacaaagatgattctcatgagaatattcaagagctccctagactgacttctggcttatgc
agagacaggttacagagcccacataaaggggaaactgaactaaggaaaaactcaaagttg
ctgaaaaaaagagccaacaggtag

KEGG   Falco peregrinus (peregrine falcon): 101910663
Entry
101910663         CDS       T02856                                 

Gene name
EVC2
Definition
(RefSeq) EvC ciliary complex subunit 2
  KO
K19608  ellis van creveld syndrome protein 2
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101910663 (EVC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fpg03036]
    101910663 (EVC2)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    101910663 (EVC2)
SSDB
Motif
Pfam: EVC2_like Claudin_2
Other DBs
NCBI-GeneID: 101910663
NCBI-ProteinID: XP_005243154
LinkDB
Position
Un
AA seq 1233 aa
MGCLGMTAMPLPLVIQASEAPHHLLTSAASDDQWSHSLFALIPSWTKKILFKRESSVNHQ
LPEDTANMSVSSGFGITLQKCGVVDVEHDPQIAYITLLINNTNMLLSANITDLILLDNIT
GLHVQKNSGNKTTDGIHIYRKRFLQGGEHFAINYSAFLDAKEMWDGRVLTLPVKLTFRSS
SQNKTHLVSLTASFTITEEEKIKVSYNHAIHAAGFFIAFFVSLVLTCAGFFIVYRTQILK
WNFHGKKKEIHHELSQNHKLEHSQFNSGDLFSEDTIMNDQIIDILTFEETGNMRLALEDL
EVASLTRADADLEAYRTQICKEVISMMMKNMVLSHSLFPHVEKKMSSIFKKQFLIMEKEI
QEEYERKMVALTAECNLETGKKVEAQCQKARAANEEAEELMKKMNEKPALEYKSLLDRLQ
RLEQDHLKRLLLVKQEEYFAKAYRQLAVTQRKELHNIFFTQITNATFKAELKMEAAKTLV
EGYSKIQGDIEELMDFLQASKKYHLNRRFAYREYLISKIQLRDSRASALINAATAQISSL
INKMERAGHLPESHLRMLLDRAEAEINSVKQKFDHDLKQEKQKLHQKLITKRRREMLQKK
EHWKEQLSLGDPFKSTKEVTHYLSHWKNLLRDHTIELEELTEKLDNEASEELKELLFSLT
EKAVEELKRVQCGVFVQELVRLNVPKVFLLEAVEEHKKEMVVKHEQLEREEGDKSVAADE
LLQLTTQKLSQELEASILEQKKIRSWEQSVFMQLLSLPLSLSEEELLRMRQELHCCFSQV
DNSLAWPKIRARTLLQAFKVEKKDTEMLKVDQNLAMTNKQQHSKMKKPGSRNRNKIDSLK
KSLQDKICIYEDSVKDEILNKIKYELLLEKEXXXXXXXXXXXLRNLEDKLGEYIASLTFQ
KTVKKSKMSELCTAIISVQALLFEQLSTSKTLSKLECIQIFEAHNTEIEELDRKLEYEML
HKESAQQQHLMSRQRWTPDELGPSREALEMNADRQVTVLLRQAMNKCRQFINLHQQRLRD
EQWNCVVLEDFLENTEMDAFLALYSQELRLTGYLAKLTRVPMGMLHRVLNLLLPSSPQSE
VLSVLDSISKYSDGVAESDNSADESGSCKKRKNQELWKALENQVRQDLINRSLEKFPSLN
KRKDSLVKKKQLAILEKASFIHLGCSPKHPPVKQFDTSVPLNTATARAIELLDTGEKIFL
FREPSDLSLHNSPRKKKKNFLNSKKAAHANTDL
NT seq 3702 nt   +upstreamnt  +downstreamnt
atgggatgtctaggaatgacagcaatgcccttacctctggtcattcaagcaagtgaagcc
cctcaccatctcttgacttctgcagcctcagacgatcagtggagccattcactgtttgct
ttgataccctcatggacaaagaagattttgttcaaacgagagtcttctgttaaccaccag
ctgcctgaagatacggccaatatgtcggtgtcttctggatttggaataacccttcagaaa
tgtggtgtggtggatgttgaacatgaccctcaaattgcatacattacacttctgattaat
aacaccaacatgctgctttcagcaaacattacagatcttatcctgctggacaatataact
ggtctacatgttcaaaaaaacagcggtaataagaccacagatggcatacacatttacagg
aaaagattcttgcaaggtggagaacactttgcaatcaactactctgcatttcttgatgca
aaagaaatgtgggatggcagagtcttgacactgcctgtgaagctaactttcaggagttca
tcacagaataaaacacatcttgtatcattgacagcttcatttaccataactgaagaagaa
aagataaaggtttcatacaaccatgccatccatgctgcagggttcttcattgcttttttt
gtttcacttgtattgacatgtgctggctttttcattgtttaccgaacacaaatattaaaa
tggaatttccatggtaaaaaaaaggagatacaccatgaactcagccagaatcacaaactg
gagcattctcagtttaattcaggtgatctctttagtgaagatacaattatgaatgaccaa
atcattgatattctgacctttgaagaaactgggaacatgcgtctggctttagaagacttg
gaggttgccagcctgacgcgggcagatgctgatctggaggcatatcgaacacagatatgt
aaagaagtgatttcgatgatgatgaagaacatggtcttaagtcacagcctctttcctcat
gtagagaagaagatgagttcaattttcaaaaagcagtttcttataatggagaaagagatt
caagaggagtatgaaagaaagatggtggctttaacagctgaatgtaatctggaaactggg
aagaaagtggaagctcaatgccaaaaagcaagggctgcaaatgaagaggctgaggaatta
atgaagaaaatgaatgaaaagcctgctttagaatataaaagtcttttggatagacttcag
agactggagcaggaccacctgaagaggttgcttctggtaaagcaggaggaatattttgca
aaggcttatagacagctggctgttacccagagaaaggagctccataatatcttttttaca
cagataacaaatgctactttcaaggcagaactgaagatggaagcagctaaaacattagtg
gaaggttattctaaaatacagggagacattgaagagctaatggattttttgcaagctagc
aagaaatatcacctgaatagaagatttgcttacagagaatatcttataagtaagatacag
ttaagggattctcgagcctctgctcttataaatgcagcaacagcccagatatcaagtctc
attaataagatggaaagagcaggtcatctacctgaaagtcatttgagaatgctgctggac
cgagctgaggctgaaattaattctgttaaacagaaattcgatcatgatttaaaacaagaa
aagcaaaagcttcaccagaaactcattaccaaacgaaggcgggaaatgctgcaaaagaaa
gagcactggaaggagcagctgtcacttggagaccccttcaaaagtactaaagaggtcact
cactacctgagccactggaaaaatcttctgagggatcacaccattgaacttgaagaactt
actgaaaaacttgacaatgaagccagtgaagagctgaaagagcttctgtttagtctaaca
gagaaagctgttgaagagcttaaacgtgttcagtgtggagtatttgtgcaagaactggtc
aggctcaatgtgccaaaggtgttcctgttagaagctgtggaggagcataaaaaagagatg
gttgttaaacatgaacagcttgaaagggaagagggtgacaagagtgtggctgctgatgag
ctgcttcagctcaccacacagaagctaagccaagaactggaagcgagcattttggaacaa
aaaaaaataaggagctgggaacaatcagtattcatgcaacttctaagtttacccctgtca
ctatcagaagaggaattgcttaggatgaggcaagagttgcactgctgcttctctcaggtg
gacaacagcttggcttggcccaagataagagcaagaacattgcttcaggctttcaaggtg
gaaaagaaggatacagagatgctgaaagtcgatcagaatttagcaatgaccaataaacag
cagcattctaaaatgaaaaaaccaggatccaggaatagaaataagatagatagtttgaag
aaatctttacaagacaaaatttgcatttatgaagactcagtgaaagatgaaattttgaat
aagattaagtacgagttgttgcttgagaaagagtgnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnctgcgcaacctggaagataaacttggagagtatattgcttctttaacctttcaa
aagactgtgaaaaaatctaaaatgtcggagctatgtactgctatcataagtgtacaagct
ttgctctttgaacaactgagcacatcaaaaaccctgtcaaaactggaatgtattcagatt
ttcgaagcccataatactgagattgaagaacttgacaggaaactggagtatgagatgttg
cataaggagtcagctcagcagcagcatctaatgagtaggcagaggtggactccagatgaa
ttgggaccttcacgtgaagctctggaaatgaatgcagacagacaagtgacagttctgcta
agacaggccatgaataaatgtagacaatttataaatctgcaccagcaaagattgagagat
gagcaatggaattgcgtagtgcttgaagatttcctggaaaatacagaaatggatgcattt
ttggcactttatagtcaggagctccgactgacaggttacttagctaaactgacaagggta
ccaatggggatgttgcacagggtcctgaacttgttgctgccctccagcccacaaagtgag
gttctttctgtactcgattccatcagtaaatattcagatggtgttgctgaaagtgacaat
agcgcagatgagtctggcagctgtaaaaaaaggaagaaccaagagttgtggaaagcactg
gagaaccaagtaaggcaagatctgataaacagaagtttggaaaagttcccttctctaaac
aagagaaaagacagcttggtaaagaagaagcaacttgccatcttggaaaaagcatcattc
attcatcttggatgttcacctaaacatcctcctgtgaaacagtttgatacatctgttccc
ttgaacactgcaactgccagagccatagaactgttagacacaggggagaagatatttttg
tttcgcgagccgagtgatctttctttgcataattctccaaggaaaaagaaaaagaacttt
cttaattccaagaaggctgctcatgcaaatacagacttgtga

DBGET integrated database retrieval system