KEGG   Falco peregrinus (peregrine falcon): 101911159
Entry
101911159         CDS       T02856                                 

Gene name
CUL1
Definition
(RefSeq) cullin 1
  KO
K03347  cullin 1
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04110  Cell cycle
fpg04114  Oocyte meiosis
fpg04120  Ubiquitin mediated proteolysis
fpg04141  Protein processing in endoplasmic reticulum
fpg04310  Wnt signaling pathway
fpg04340  Hedgehog signaling pathway
fpg04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101911159 (CUL1)
   04120 Ubiquitin mediated proteolysis
    101911159 (CUL1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101911159 (CUL1)
   04340 Hedgehog signaling pathway
    101911159 (CUL1)
   04350 TGF-beta signaling pathway
    101911159 (CUL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101911159 (CUL1)
   04114 Oocyte meiosis
    101911159 (CUL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fpg04121]
    101911159 (CUL1)
Ubiquitin system [BR:fpg04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     101911159 (CUL1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 101911159
NCBI-ProteinID: XP_005236077
LinkDB
Position
Un
AA seq 776 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcatcaaataggagtcagaacccacatggacttaaacagattggtcttgaccagata
tgggatgacctaagagctggaattcaacaggtttataccagacaaagtatggcaaaatcc
agatacatggaactctacactcatgtttataactactgtactagtgtacaccagtctaat
caagcacggggagctggagtacctccttctaaatcgaaaaagggccagacacccggaggt
gctcagtttgttggcttggaattgtacaaacggctaaaagaatttctgaagaactacttg
acaaatctccttaaggatggtgaggatttgatggatgagagtgtgctgaaattctacact
caacagtgggaagattataggttttcaagcaaagtattgaatgggatatgtgcctacctc
aatcgacattgggttcgtcgtgagtgcgatgaaggtcgtaaaggaatatatgaaatttat
tcacttgccttggtgacctggagagactgcttattcaggccattaaataagcaggtaaca
aatgctgtgttgaagttgattgaaaaggaaagaaatggtgaaactatcaatacaaggctg
atcagtggagttgtacaatcttatgtggagctggggctgaatgaagatgatgcatttgca
aaaggacctacactaactgtctataaagaatcctttgaatctcagtttcttgctgacaca
gagagattttatacacgagaaagtactgaatttttgcaacagaacccagtcacggagtac
atgaagaaggctgaagctcgccttctggaggaacagcgcagagttcaggtatatctccat
gagagcacacaagatgagttagcacgaaaatgtgagcaagtacttattgaaaaacacctg
gagatatttcatacagaatttcagaatttgttggatgctgacaaaaatgaagacttggga
cgcatgtataacctcgtatctcgaatccaggatggccttggagagctgaaaaaacttttg
gaaacccacattcataatcagggtctagctgcaattgagaaatgtggagaagctgctcta
aatgatcccaaaatgtatgtacagacagtgttggatgtccataagaagtacaacgcttta
gtcatgtctgcattcaacaatgatgctggctttgtggctgcgctagacaaagcttgtggt
cgatttataaataataatgcagtgacaaaaatggctcaatcatccagtaaatcaccagag
ctactggcacgatactgtgactctttactaaagaaaagctcaaagaatcccgaagaagca
gaattggaagatacactcaatcaagtgatggttgtcttcaagtacattgaagacaaagat
gtgtttcaaaaattctatgccaaaatgctggcaaaaagacttgtacatcagaacagcgct
agtgatgatgctgaggccagcatgatctctaaactgaaacaagcttgtggttttgagtat
acctccaagctgcagcggatgttccaagatattggtgtaagcaaggacttgaatgagcaa
tttaaaaagcacctgaccaattcagaaccgttagatttggatttcagcatccaggtgctg
agctctggatcgtggccgttccagcagtcctgcacgtttgctctgccgtctgagttagaa
cggagctatcagagatttactgcattttatgccagtcgtcatagtggaagaaaattaaca
tggttgtatcagctgtccaaaggggaactggttaccaactgtttcaagaacagatacacg
ttacaggcatccacattccagatggcgattttactgcagtacaacacagaagatgcctat
accgtgcagcagctgacagacagtacccaaataaaaatggatatcttggcacaagttcta
cagatactgttgaaatcgaaattgcttgttttggaagatgaaaatgcaaatgttgatgag
gtggagttaaaaccagataccttaataaaactgtatctcggttataaaaacaaaaaatta
agggttaacatcaatgtgccaatgaagactgaacagaagcaggagcaagagactacacac
aaaaatatagaagaagataggaaactattgattcaggctgctatcgtgagaatcatgaaa
atgaggaaggttctaaaacaccagcaactgcttggagaagtgctaacacagctgtcttca
aggtttaagccacgagttccagtaattaagaaatgcatcgacattctgattgagaaagag
tacttggaacgcgtggatggtgagaaggacacctacagttacttggcttaa

DBGET integrated database retrieval system