KEGG   Falco peregrinus (peregrine falcon): 101911546
Entry
101911546         CDS       T02856                                 

Definition
(RefSeq) chromosome unknown open reading frame, human C16orf52
  KO
K23663  modulator of smoothened protein
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101911546
SSDB
Motif
Pfam: Atthog Cyt_bd_oxida_I LtrA L_HMGIC_fpl DUF998
Other DBs
NCBI-GeneID: 101911546
NCBI-ProteinID: XP_005229123
LinkDB
Position
Un
AA seq 167 aa
MVDTCVFQKKSLTDGDTHRSEKLEIWPRRGSVQDTCALTVGLVRQCQTIHGRDRTCIPPR
LPPEWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIG
FYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 504 nt   +upstreamnt  +downstreamnt
atggttgatacctgtgtatttcagaagaagtctctgactgatggagatacacacagatct
gaaaaactggagatatggccaagaagaggatctgtgcaggatacgtgtgctctcacagtt
ggccttgtgcgacagtgtcaaaccatccatggacgtgacaggacctgtattcctccacgg
ctgcctcctgagtgggtcactacgttatttttcatcattatgggaatcatttcactaact
gtcacatgtggtttgctggtggcttcccactggcgaagagaagctactaaatatgcccgc
tggatagctttcactggaatgattctattctgtatggcagccctaatatttccaattgga
ttttacatcaatgaagttggaggtcaaccatataaattacccaataacacagtggttggg
tcttcgtatgtactgtttgtcttatccattttctttacaatagtgggacttctatttgct
ggcaaagtttgtttacctggctga

DBGET integrated database retrieval system