KEGG   Falco peregrinus (peregrine falcon): 101911656
Entry
101911656         CDS       T02856                                 

Gene name
GRK2, ADRBK1
Definition
(RefSeq) G protein-coupled receptor kinase 2
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04144  Endocytosis
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101911656 (GRK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101911656 (GRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101911656 (GRK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpg04147]
    101911656 (GRK2)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     101911656 (GRK2)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   101911656 (GRK2)
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101911656 (GRK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal HTH_WhiA
Other DBs
NCBI-GeneID: 101911656
NCBI-ProteinID: XP_005243492
LinkDB
Position
Un
AA seq 646 aa
MQKYLEDRGEVTFDKIFTQKIGYLLFRDFAFNQAEEAKPLMEFYEEIKKYEKLDSEEERT
VRSRHIFDHYIMKELLACSHPFSKSATEHVQSRLSKKQVPPDLFQPYIEEICQNLRGGIF
QKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCL
DKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYH
LSQHGVFSEAEMRFYAAEIILGLEHMHSRFVVYRDLKPANILLDEFGHVRISDLGLACDF
SKKKPHASVGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEI
DRMTLTMAIELPDSFSPELRSLLEGLLQRDVNRRLGCMGHGAQEVKEEPFFKGLDWQMVF
LQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLESDQELYRNFPLTISERWQQEVT
ETVFEAVNADTDKLEARKKAKNKQLGHEEEYAMGKDCIMHGYMAKLGNPFLTQWQRRYFY
LFPNRLEWRGEGESPQSLLTMEEIDSVEETQVKERKCILLRIRGGKQFVLQCDSDPELVQ
WRKELRDAQRQAQQLLQRVPRMQNKPRSPVVELSKVPFIQRSANGL
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgcagaaatacctggaggaccggggagaggtgacgttcgacaagatcttcacgcagaag
atcgggtacctgctgttccgtgacttcgcctttaaccaggcagaggaggccaaacccctg
atggagttttatgaggagatcaagaagtatgagaagctggactcggaggaggagcgaact
gtccggagccgccatatctttgaccattacatcatgaaggagctgctggcctgctcccac
cccttctccaagagtgccacggagcatgtccaaagccgcctgagcaagaagcaggtgccc
ccagacctcttccagccctacattgaggagatctgccagaacctgcgtgggggtatcttc
cagaaattcatcgaaagtgacaagttcacacggttctgccagtggaagaacgtggagctg
aacatccatctcaccatgaacgacttcagtgttcaccgaatcatcggccgtggtggtttt
ggggaggtctacggctgccggaaagcagatacgggcaaaatgtatgccatgaagtgtttg
gacaagaaacgcatcaagatgaagcagggtgagaccctggccctcaacgagcgcatcatg
ctgtccctcgtcagcactggggactgcccattcatcgtgtgcatgtcctacgccttccac
acgcccgacaagctcagcttcatcctcgacctcatgaacgggggagacctgcattatcac
ctgtcccagcacggtgtcttctcggaggcagagatgaggttctacgcggctgagatcatc
ctgggcctggagcacatgcacagccgctttgtggtgtaccgtgacctcaagccggcaaac
atcctcctggatgagtttgggcacgtccgcatctcagacctgggcctggcctgtgacttc
tccaagaagaagccccatgccagtgtgggcacccatgggtacatggctccagaggtgctg
cagaaaggagtggcgtacgacagcagcgctgactggttctcactgggctgcatgctgttc
aagctgctccgggggcacagcccctttcggcagcacaagacgaaggacaagcatgagatc
gaccgtatgaccctcaccatggccatcgagctgccagactccttctcccccgagttgcgc
tccctcctcgaggggctgctgcagcgagacgttaaccggcggctgggctgcatggggcac
ggggctcaggaggtgaaggaggagcccttcttcaagggtctggactggcagatggttttc
ctgcagaagtacccaccgcccctgatcccaccccgcggtgaggtgaatgcggctgacgcc
tttgacatcggctcctttgatgaggaggacacgaagggcatcaagctgctggagagcgac
caggagctgtaccgcaacttcccactcaccatctcggagcggtggcagcaggaggtgacg
gagactgtcttcgaagccgtcaacgctgacaccgacaagctggaagctcgcaagaaggcc
aagaacaagcagctgggccatgaggaggagtatgccatgggcaaggactgcatcatgcac
gggtacatggccaagctgggcaaccccttcctgacacagtggcagcgccgctacttctac
ctcttccccaaccgcctggagtggcgcggggagggcgagtcaccgcagtccctgctcacc
atggaggagatcgactcagtggaggagacgcaggtgaaggagcgcaagtgcatcctgctc
cgcatccgcggtggcaagcagttcgtgctgcagtgtgatagtgaccccgagctggtgcag
tggcggaaggagctgcgggacgcccagcgccaggcccagcagctgctgcagcgggtgccg
cgcatgcagaacaagccccgctcgcccgtggtggagctcagcaaagtgccgttcatccag
cgctctgccaacgggctctga

KEGG   Falco peregrinus (peregrine falcon): 101916842
Entry
101916842         CDS       T02856                                 

Gene name
GRK3, ADRBK2
Definition
(RefSeq) G protein-coupled receptor kinase 3
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04144  Endocytosis
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101916842 (GRK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101916842 (GRK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101916842 (GRK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpg04147]
    101916842 (GRK3)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     101916842 (GRK3)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   101916842 (GRK3)
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101916842 (GRK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 101916842
NCBI-ProteinID: XP_013160668
LinkDB
Position
Un
AA seq 646 aa
MQKYLEERGELTFDKIFHQKIGFLLFKDYCMNEIDEAVPQLKFYEEIKEYEKLDSEDERL
TRSRQIYDTYIMKELLSCSHPFSKQAVDHVQTHLAKKQVPASLFQPYIEEICDSLRGKIF
QKFMESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCL
DKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYH
LSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDF
SKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEI
DRMTLTVNVELPDSFSPELKSLLEGLLQRDVSKRLGCQGRSAQEVKEHPFFKGIDWQQVY
LQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYKNFPLVISERWQQEVA
ETVYDAVNADTDKIEARKRAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFY
LFPNRLEWRGEGESRQNLLTMEQIVSVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQ
WKKELTEAFTEAQRLLRRAPKFLNKSRSTVVELSKPPLSHRNSNGL
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgcagaaataccttgaggaaaggggtgaattaacctttgacaagatctttcatcagaaa
attggatttttgctttttaaagactattgcatgaacgagattgatgaagctgtccctcaa
ctgaagttttatgaagagataaaagaatatgagaaactggattctgaggatgagcgtctg
acccgaagtcggcagatttatgacacgtacataatgaaggagctcctctcctgttcgcat
cctttctcaaaacaagctgtagatcatgtacaaacgcatttagccaagaaacaagtgcca
gccagcctttttcagccatatatagaagaaatttgtgatagtctccgaggaaaaatattt
caaaaatttatggaaagtgacaagtttactagattttgtcaatggaaaaacgtagaacta
aatattcatctgaccatgaatgattttagtgtacatagaataataggaagagggggattt
ggtgaagtgtatggttgcagaaaagcagacactggaaaaatgtatgcaatgaaatgttta
gataagaagagaatcaagatgaagcaaggagaaacattagccttaaatgaaagaattatg
ctgtctcttgtcagcacaggggactgtccttttatagtgtgtatgacctatgccttccac
acccctgacaagctctgtttcattctggacctgatgaatggaggagatttgcactaccac
ctctcccagcacggagtgttttctgaaaaagaaatgagattttatgctactgaaatcatc
ctgggtttagaacacatgcacaatcgctttgttgtatacagagacctaaagcctgcaaat
atcttgttggatgaacatgggcacgtgaggatatcagaccttgggctggcttgtgatttt
tccaaaaagaagccacatgctagtgtcggtacccatggatacatggctcctgaggtgctc
cagaagggaacagcatacgacagcagtgcagactggttctcattaggctgcatgcttttc
aagcttctaagaggtcacagtcctttcagacagcacaaaaccaaagataagcatgagatc
gaccggatgacgctcaccgtgaatgtggagctaccagattcattttctcctgaactgaag
tcccttttggaagggctcctgcaacgggatgttagcaagagacttggatgccaaggaaga
agtgcacaagaagtaaaagaacatccattcttcaaaggcattgattggcagcaagtctat
ttacaaaagtatcctccaccacttattcctccccggggagaagtaaatgcagcagatgct
tttgatattgggtcatttgatgaagaggacactaaaggcattaagttgcttgatagtgac
caggaattatataagaacttccctctggtaatatcggagcgttggcagcaagaagtagca
gaaactgtttatgatgcagtaaatgcagacacagataaaattgaggccagaaaaagggct
aaaaataagcagcttggccacgaggaagattatgcacttgggaaggattgtattatgcac
ggatacatgctgaaattggggaacccattcttgactcagtggcagcgtcgctacttttac
ctcttcccaaaccggcttgaatggcgaggggaaggagagtcccggcaaaacctgctgaca
atggaacaaatagtatctgttgaagaaacacaaattaaagacaagaaatgtatcttactg
agaattaaaggaggaaaacagtttgtcctacagtgtgagagtgacccagaatttgttcag
tggaaaaaagagctgacagaagcttttactgaggcacagaggttgctgcgtcgagctcca
aagtttctcaataaatctcgctcaacagttgtagagctttcaaaaccaccactcagccac
aggaatagcaatggtctgtag

DBGET integrated database retrieval system