KEGG   Falco peregrinus (peregrine falcon): 101912073Help
Entry
101912073         CDS       T02856                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101912073 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fpg03036]
    101912073 (SETDB1)
Enzymes [BR:fpg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101912073 (SETDB1)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101912073 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101912073 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5604 SET Tudor_4 TUDOR_5 Pre-SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 101912073
NCBI-ProteinID: XP_013160257
LinkDB All DBs
Position
Un
AA seq 1280 aa AA seqDB search
MDSQEIKELQQEVMDELGISMEELQDIIDKELEKFECVKQRKQQLEELEKCVKQKEEEVA
HVDRLFDDASRAIDKCEILVKDLYSKLGLQYRESSSEDEDLAAKPTEVIEIPDEDDDDVM
SIDSGWKHSNSSSRIAKDQTLLREAMAAMRKSAQDVQRFMDAVNKKTNAQDAQKDAQTPQ
ETSSAVQPVGLAAGGSDLSNDGDLNVGMRILGKKRTKTWHKGTLIAIQTIGVGKKYKVKF
DNKGKSLLSGNHIAYDYHPAPEKHYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKDRFL
IFFDDGYASYVKEWELYPVCRPLKKTWEDIEDVSCRDFIEEYITAYPNRPMVLLKNGQLI
KTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSTASTQEKKQS
GQARTRPNVGAVRSKGPVVQYTQDLTGAGTHYKPLEQMQAASLAAQSVSPQPAEMECTDS
QLAQSRKQVAKKSTSFRPGSVGSGQSSPSSPVLSDAPPSGRLSAAPQHRLASGQAGGGAA
QAFHGMMDRVPNEPSYRAPLEKLFYLPHVCSYTCLSRVRPIRSDQYRSKNPLLIPLLYDF
RRMTARRRVNRKMGFHVLYKTPCGLCLRTMQEIERYLFETDCDFLFLEMFCLDPYVLVDR
KFQPYKPYYYIADITKGKEDVPLSCVNEIDNTPPPQVAYSKERIPGKGVYINTSWEFLVG
CDCKDGCRDKSKCACHQLTVQATGCTPGGQINPNAGYQHKRLEECLPTGVYECNKRCKCN
VNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGLE
MGDEYFANLDHIESVENFKEGYESDAKCSSDSSGVDLKDEEEENTGTEEQEESNEDSSDD
NFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETASKDSGLTRQISHDETAVATSCKLPI
SEETSKNKVASWLSSNSMSDTFQDNDSTSSFKMSEGGEAKVSKTELPGEREKTCAAAPGE
LDGESKAPKKDEPEDSSKILGLSDVGRMYGYNPSPPKLEGVRRPMSKTALLQSRRHSLTP
QPTTDDVLTLSSSTDSDGENGRAAAGQAQGTTNDSDDIQTISSGSEEEEGDDKKNPSSGS
AGPVKRQVAVKSTRGFALKSTHGIAIKSTNMAAADKGESAPVHKTTRQFYDGEESCYIID
AKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGS
VEGKELLCCCGAIECRGRLL
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atggattcccaggagatcaaagagctgcagcaagaagtgatggacgagctgggaatctcc
atggaggagctccaggatatcattgacaaagagctggagaagtttgagtgtgtgaagcaa
aggaagcagcagctggaggagctggagaagtgcgtgaaacagaaggaagaagaggtggct
catgttgaccggctctttgatgacgcttcgagagctattgataaatgtgagatactggtg
aaggatctgtactccaagctgggcctccagtaccgtgagagcagctctgaggacgaggac
ttggctgccaagcccacagaagtgattgagatcccagatgaagacgacgacgatgtcatg
agtatcgattcgggctggaagcacagcaacagtagttccagaatcgcaaaggatcagact
ctgctgcgggaagccatggctgcaatgagaaagtctgcccaggatgtgcagagatttatg
gatgcggtgaacaagaaaacaaatgctcaggatgcacaaaaagatgcacaaacccctcag
gaaacttccagtgctgtccagcccgttggccttgcagcaggtgggagcgatctcagcaat
gacggtgatctgaacgttggcatgaggatcctgggcaaaaagagaaccaaaacgtggcac
aaaggaactctaatcgccatccagacgatcggtgttgggaagaagtacaaagtgaaattt
gataataaagggaagagtttgctttctggcaatcacattgcttatgactatcaccccgcg
cctgagaaacactacgttggcagcagggttgtggcaaaatacaaagacgggaatcaggtt
tggctgtatgctggcattgtggctgaaaccccaaatgtgaagaataaagatagattcctg
atcttctttgatgatggctatgcttcatatgtcaaggagtgggagctgtacccagtctgc
aggccactaaaaaagacctgggaagacatagaggatgtttcctgtcgtgatttcattgag
gagtacatcacagcctaccccaaccggcccatggtactgctgaagaacggacagctgatc
aaaaccgagtgggaagggacctggtggaaatccagagtggaagaagtagatggcagtctg
gtcagaatccttttcctggatgataaacgctgtgagtggatttaccggggttccacacgc
cttgagcccatgttcagcatgaaaacttccacggcctccacccaagaaaagaagcaaagt
ggacaagcgaggactcgtcccaatgtcggtgccgtcaggagcaaagggcccgtagtacaa
tatacccaggatttaacaggagctggtacccattacaaacctttagagcaaatgcaggcg
gcctcgctggctgcacagtccgtgtctccgcagcctgctgagatggagtgcaccgacagt
cagctggcccagtcgaggaagcaagtggccaagaaaagcacatccttccgtcctggctcc
gtgggttccgggcagtcatcgccttcttcacctgtcctaagcgatgcacctccatcggga
cggctgagcgcagccccgcagcatcggctcgccagcggccaggcaggcggtggcgcagcg
caggccttccatggcatgatggaccgcgtgcccaacgagccctcttaccgagccccgctg
gagaaactcttctacctgccgcacgtctgcagctacacctgcctgtcccgcgtccgtccc
atccgcagcgatcagtaccgcagcaagaaccccctgctcatcccgctgctctacgacttc
cgacggatgacagcccgccgacgggtgaaccgcaagatgggcttccacgtcctctacaag
acaccctgtgggctgtgcctgaggaccatgcaggagatcgagcgctaccttttcgagaca
gactgcgacttccttttcctggagatgttctgcctggatccctacgtgctggtggatcgc
aagttccagccctacaagccctactactacatcgcagacattaccaagggtaaggaggac
gtgccgctgtcctgtgtcaacgagatcgataacaccccgcctccccaagtggcctacagc
aaggagcgcatccccggcaaaggggtttacatcaacaccagctgggaattcctcgtgggc
tgcgactgcaaggacggctgcagggacaaatcgaaatgtgcctgtcaccagctgacagtc
caggcgactggctgtaccccaggtgggcagatcaaccccaacgcaggataccagcacaaa
aggctggaagaatgcctcccgacaggagtttacgagtgtaacaagaggtgcaagtgcaac
gttaacatgtgcaccaaccgcctggtccagcacgggctccaagtccgactgcagttattc
aagacgcagaacaaaggctggggcattcgctgccttgatgacattgctaaaggctccttc
gtctgcatctacgcagggaaaatcctcacagatgactttgccgacaaagaggggttagag
atgggtgacgaatattttgcgaacctggatcacattgagagcgtggagaacttcaaggag
ggctacgagagcgatgcaaagtgctcttctgacagcagcggggtggacctcaaggatgaa
gaggaggaaaacacaggcaccgaggagcaggaggagtccaacgaggacagctctgatgac
aacttctgcaaggatgaggacttcagtaccagctcggtgtggcgcagctatgccacgcga
cggcagacccggggccagaaggagaatgggctgtcggagacagcctccaaggactcgggg
ctcacccggcaaatcagccacgacgagacggcagtggccacctcctgtaagctgccgata
tcggaggaaacctccaagaacaaagtggcctcatggctgagctccaacagcatgtctgac
accttccaggacaacgacagcacctcctccttcaagatgagcgaaggcggcgaggccaag
gtcagcaaaacggagctcccgggtgagcgagagaaaacctgtgctgctgccccgggcgag
ctggatggagagtcaaaggcaccgaagaaagatgaacctgaagactcaagcaaaattctt
gggctgagcgacgtgggaaggatgtacggctacaaccccagccctcccaaactggaaggg
gtccggaggccgatgagcaagacggccctgctgcagagcaggcggcattccctcaccccg
cagcccaccacagacgacgtgctgaccctgtccagcagcaccgacagcgacggggagaac
gggcgggcggcggcggggcaggcccagggcaccaccaacgacagcgacgacatccagacc
atttcctcgggctccgaggaggaggaaggggatgacaagaaaaatccctcgtctggctca
gcaggtcccgtgaagaggcaggtggcggtgaaatccacccggggcttcgccctgaaatcg
actcacggcatcgccatcaagtccaccaacatggcagcagccgacaagggcgagagcgcg
cccgtccataaaaccactcgccagttctacgacggagaggagtcctgctacatcatcgat
gccaagctggagggcaacctgggccggtacctcaaccatagctgcagtcctaacctcttc
gtgcagaacgtttttgtggacacgcacgacctccgcttcccctgggtcgccttcttcgcc
agcaagaggatacgagccggcacggagctgacatgggattacaactacgaagtaggcagc
gtggaaggcaaagagctgctgtgctgctgcggggctatcgagtgccgagggcggctgctc
tga

DBGET integrated database retrieval system