KEGG   Falco peregrinus (peregrine falcon): 101912129Help
Entry
101912129         CDS       T02856                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00240  Pyrimidine metabolism
fpg00983  Drug metabolism - other enzymes
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    101912129 (TK1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101912129 (TK1)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101912129 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK ATPase_2 RecA AAA_14
Motif
Other DBs
NCBI-GeneID: 101912129
NCBI-ProteinID: XP_005244006
LinkDB All DBs
Position
Un
AA seq 224 aa AA seqDB search
MNCLTVPGVHPGSPSRPRGQIQVIFGPMFSGKSTELMRRVCRFQLAQHRCLLVKYTKDTR
YCSSGVSTHDKNIMEALPACLLKDVYQEALSSAVIGIDEGQFFPDIVEFCEMMANAGKTV
IVAALDGTFQRKAFGSILNLVPLAESVVKLNAVCMECYREASYTKRLGAEREVEVIGGAD
KYHSVCRTCYFRKRPQQPGLENKENMPMGVKQLDMAASWKIFAS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtctcacggtgcccggcgtccaccccggctcgcccagccgcccgcgcgggcag
atccaggtgatcttcggacccatgttctctgggaagagcacggagctcatgcggcgggtg
tgtcggttccagctcgctcagcaccgatgcctgctggtgaagtacaccaaggacacgcgc
tactgcagctctggcgtctctacacacgacaagaacatcatggaggccctgccagcctgc
cttcttaaggacgtgtaccaggaggcactgagctctgcggtcattggcattgatgagggc
cagtttttcccagacatcgtggagttctgtgagatgatggccaatgctgggaaaactgtc
attgttgctgctcttgatgggacttttcagagaaaggcctttgggagcatcctgaacctg
gtgccgctggcagagagcgtggtgaagctgaacgccgtgtgcatggagtgctacagagaa
gcctcctacacaaagaggctgggagcagagagggaggttgaagtgattggaggagcagac
aagtaccactctgtctgccgaacctgctacttccgcaagaggcctcagcagcctgggttg
gaaaacaaggagaacatgcctatgggggtgaagcaactggatatggcggcctcctggaag
atctttgcttcttga

DBGET integrated database retrieval system