KEGG   Falco peregrinus (peregrine falcon): 101912177Help
Entry
101912177         CDS       T02856                                 

Gene name
PTEN
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00562  Inositol phosphate metabolism
fpg01100  Metabolic pathways
fpg04068  FoxO signaling pathway
fpg04070  Phosphatidylinositol signaling system
fpg04115  p53 signaling pathway
fpg04140  Autophagy - animal
fpg04150  mTOR signaling pathway
fpg04218  Cellular senescence
fpg04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101912177 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101912177 (PTEN)
   04070 Phosphatidylinositol signaling system
    101912177 (PTEN)
   04150 mTOR signaling pathway
    101912177 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101912177 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    101912177 (PTEN)
   04218 Cellular senescence
    101912177 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101912177 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fpg01009]
    101912177 (PTEN)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101912177 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     101912177 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     101912177 (PTEN)
Protein phosphatases and associated proteins [BR:fpg01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    101912177 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 101912177
NCBI-ProteinID: XP_005242647
LinkDB All DBs
Position
Un
AA seq 369 aa AA seqDB search
MGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHN
PPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDF
YGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSSGTCNPQ
FVVYQLKVKIFTSPSGPSRREDKYMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFW
VNTFFIGLDENSDKVENGSLVADQELDGIFSTERSDNDKEYLILTLTKNDLDKANKDKAN
RYFSPNFKVKLFFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDE
DQHTQITKV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcctgcggagaggcttgaaggagtataccggaacaacattgatgatgtagta
aggtttttggattcaaaacataaaaaccattacaagatatacaatctatgtgctgaaaga
cattatgacaccgccaaatttaattgcagagttgcacagtacccttttgaagaccataac
ccaccacagctagagcttatcaaacctttttgtgaagatcttgaccaatggctaagtgaa
gatgacaatcatgttgcagcaatccactgtaaagctggaaagggacgaactggtgtaatg
atatgtgcatatttgttgcatcgaggcaagtttttaaaggctcaagaagccctagatttc
tatggggaagtaaggaccagagacaagaagggagtaacaattcccagtcagagacgctat
gtgtactactatagctacctgttaaagaatcaccttgattacagaccagtggcactgctg
tttcacaagatgatgtttgaaacaattcccatgttcagcagcggaacttgcaatcctcag
tttgtggtataccagctaaaggtaaagatattcacctccccttcaggaccctcaagacgt
gaagacaagtatatgtactttgaattccctcaacctttgccggtatgcggtgatatcaaa
gtggaatttttccacaaacagaacaagatgttgaaaaaggacaaaatgtttcacttttgg
gtaaatacattcttcataggactggatgaaaattcagacaaagtagaaaatggaagtcta
gttgcagatcaggaacttgatggtattttcagtacagagcgctcagataatgataaggaa
tatttaatccttacattaacaaaaaatgatctagacaaagcaaataaagacaaagccaac
agatatttctctcccaacttcaaggtgaagctatttttcacaaaaacagtagaagagcca
tcaaatccagaggctagcagttcaacttctgtaacaccagatgttagtgacaatgaacct
gatcattatagatattctgacaccactgactctgatccagagaatgaacctttcgatgaa
gatcagcatacgcagattacaaaagtctga

DBGET integrated database retrieval system