KEGG   Falco peregrinus (peregrine falcon): 101912554
Entry
101912554         CDS       T02856                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog
  KO
K11988  sonic hedgehog
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101912554 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fpg01002]
    101912554 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:fpg00536]
    101912554 (SHH)
Peptidases and inhibitors [BR:fpg01002]
 Cysteine peptidases
  Family C46: hedgehog family
   101912554 (SHH)
Glycosaminoglycan binding proteins [BR:fpg00536]
 Heparan sulfate / Heparin
  Morphogens
   101912554 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 101912554
NCBI-ProteinID: XP_005233998
LinkDB
Position
Un
AA seq 425 aa
MDEMLLLTRILLVGFICALLVSSGLTCGPGRGIGKRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLVADAEGRLLYSD
FLAFLDREDGSHKLFYVIETRQPRARLLLTAAHLLFVAPQHNQSQAGTPSSRALFASRVR
PGQRVYVLGEGGQQLLPAAVHSVSLREEASGAYAPLTAQGTILINRVLASCYAVIEEHSW
AHWAFAPFRLLQGMLATLCPSGGGAPMAAPTTPGIHWYSRLLYRIGSWVLDSDSLHPLGM
VVPSS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggacgaaatgctgctgttgacaagaattcttttggtgggcttcatctgcgctctttta
gtctcctctgggctgacttgtggaccaggcaggggcattggaaaaaggagacaccccaaa
aagctgacccctttagcctataagcagtttattcccaatgtggcagagaagaccctaggg
gccagtggaagatatgaagggaagatcacaagaaactccgagagatttaaagaactaacc
ccaaattacaaccctgacattatttttaaggatgaagagaacacgggagctgacagactg
atgactcagcgctgcaaggacaagctgaacgccctggcgatctcggtgatgaaccagtgg
cccggggtgaaactgcgcgtgaccgagggctgggacgaggatggccaccactccgaggag
tccctgcactacgagggccgcgccgtggacatcaccacttcggaccgggaccgcagcaag
tacggcatgctggcccgcctggccgtcgaggctgggttcgactgggtctactatgagtcc
aaggcgcacatccactgctccgtcaaagcagaaaactcagtggcggccaaatcggggggc
tgcttccccggctcggccacggtgcacctggagcaaggcggcaccaagctggtgaaggac
ctgagccccggggaccgggtgctggtggccgacgcagagggccgactgctctacagtgac
ttcctcgctttcctcgaccgggaggatggctcccacaagctcttctatgtcatcgagaca
cggcagccccgagcccggctgctgctgacagctgcccacctcctcttcgtggccccacaa
cacaaccagtcgcaggcggggacccccagcagccgggcgctcttcgccagccgcgtacgg
ccgggccagcgggtctacgtgttgggcgagggcgggcagcagctcctgccagcagccgtg
cacagcgtctcactgcgggaggaggcttcaggggcgtacgccccgctcaccgcccagggc
accatcctcatcaaccgggtgctggcctcttgctacgccgtcatcgaggagcacagctgg
gcgcactgggcgttcgctcccttccgcctgctccaggggatgctggccaccctctgcccc
tctggcgggggggcccccatggctgcccccaccacccctggcatccactggtactctcgc
ctcctctaccgcattggcagctgggtgctggatagtgactctctgcacccactgggcatg
gtggtgccatccagctga

KEGG   Falco peregrinus (peregrine falcon): 101921899
Entry
101921899         CDS       T02856                                 

Gene name
IHH
Definition
(RefSeq) indian hedgehog
  KO
K11989  indian hedgehog
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101921899 (IHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fpg01002]
    101921899 (IHH)
Peptidases and inhibitors [BR:fpg01002]
 Cysteine peptidases
  Family C46: hedgehog family
   101921899 (IHH)
SSDB
Motif
Pfam: Hint HH_signal Peptidase_M15_3
Other DBs
NCBI-GeneID: 101921899
NCBI-ProteinID: XP_005234375
LinkDB
Position
Un
AA seq 294 aa
MNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGMLARLAVEAGFDWV
YYESKAHIHCSVKSEHSAAAKTGGCFPGRALATLEDGAQTPLWALRPGQRVLAMDGTGRP
TYSDFLAFLDKDPHTLTSFHVIETREPPRRLVLTPTHLLFVAENASAPATHFRPTFASRV
HPGHFVLVAVVGGGLQPAEVVEVWDRRDVGAYAPLTRHGTLVVDGVVASCFALVQEQHLA
QLAFWPLRLYHSLVGWPGVQGDGVHWYSGLLYRLGRLLLPPDSFHPLGVPQMES
NT seq 885 nt   +upstreamnt  +downstreamnt
atgaatcagtggccaggggtgaagctgagggtgacagagggctgggacgaggatgggcac
cactcagaggagtcactgcattacgagggccgagccgtggacatcacgacatcggatcgg
gaccgcaacaagtacggcatgctggctcgcctggccgtggaggctggcttcgattgggtc
tactatgagtccaaagcgcacatccactgctccgtcaagtcagagcactcagccgctgcg
aagacggggggctgcttccctgggcgggcactggcgacgctagaggatggtgcccagact
ccactgtgggcactgcgcccaggccagcgggtgctggcaatggacgggaccggcaggccc
acatacagcgacttcctggctttcctggacaaggacccccataccctcacctccttccat
gtcatcgagacgcgggagccaccccgacgcctggtcctgacacccacccacctgctcttt
gtggccgagaatgcctcggcgcctgccacccacttccgtcccacctttgccagccgtgtg
caccctggacattttgtgctagtggcagtggtggggggcggcttgcagcctgctgaggtg
gtagaggtgtgggaccggagggacgtgggagcctatgccccgctgacacgccatgggacg
ctggtggtggatggcgtggtggcctcgtgctttgccctagtgcaggagcaacatctggcg
cagctggccttctggccactccggctctaccatagcctagtggggtggccaggggtgcag
ggggacggtgtgcactggtactcggggctgctttaccgcttgggcagactgcttctgccc
cctgacagcttccacccactgggggtaccccagatggagagctga

DBGET integrated database retrieval system