KEGG   Falco peregrinus (peregrine falcon): 101913531
Entry
101913531         CDS       T02856                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
fpg04020  Calcium signaling pathway
fpg04144  Endocytosis
fpg04510  Focal adhesion
fpg04540  Gap junction
fpg04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101913531 (PDGFRA)
   04020 Calcium signaling pathway
    101913531 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101913531 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101913531 (PDGFRA)
   04540 Gap junction
    101913531 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101913531 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101913531 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fpg04090]
    101913531 (PDGFRA)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101913531 (PDGFRA)
Protein kinases [BR:fpg01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101913531 (PDGFRA)
CD molecules [BR:fpg04090]
 Proteins
  101913531 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 101913531
NCBI-ProteinID: XP_005232157
LinkDB
Position
Un
AA seq 1087 aa
MGTSPRTFLILACFLTGPFLTFCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGLYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPTVIPCRTSDPNAPVTLVNSLDKAVYAFYDSKQGFIG
NFPAGSYTCKTMVKGVEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEVKRYTFSLLIQVPALILDL
VDDHHGSAGGQMVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWALLTNNISDVHMEVHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSMSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacttccccacggacgttcctgatcctggcatgctttctcacaggaccgttccta
acattttgccagcttcctctgccgactattgttcccaataggaatgaaatggtggtacag
ctgaattccaatttcacgctcaaatgctctggagacagtgaagtgagctggcagtaccca
gtgaccgagggaagccacaggatagacattagacatgaagaaaacaacagtggcctcttc
gtgacggtgctcgaagtaggaaatgcctcggctgctcatacgggcttgtatgtttgctat
tataaccacactcaagtggaggatggggaagtggaagggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttctataccagaagaccagttcatcctagtagaa
gaaggggatcccactgttatcccttgtcggacaagtgacccaaatgctccagtgacttta
gtcaacagtttagacaaggctgtctatgctttctatgacagcaaacaaggcttcataggg
aatttccctgcggggtcatatacatgcaaaacaatggttaaaggcgtggagttcaagtct
gatgagttcctcatctatattttaagagctacttcacagctgccggttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggtaaatttacagtggaattatcctgggaaagtgaaagaaaaaggtctgataaag
cttgatgatatcaaagtcccatcgcagaagctggtttacaccttgaccattcctgaggca
tcagtgaaagacacaggggattatgaatgtactgctcggcatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaaggcttcattcacctggagccccag
tttagccctctggaggctgtcaatctacatgaagtcaaaaactttgtcgtcgatgtgcag
gcatacccagcaccaaaaatgtactggttgaaggataatgtgactctgatcgaaaatctt
actgagattgttactagttccaacagagtgcaggaaacaaggtttcaaagtatattaaaa
ttgatccgggccaaggaagaagacagcggatactatactttggttgctgaaaatgaagat
gaggttaaaagatacaccttctccttgctgatacaagttccagcactgatcttagacctt
gtggacgatcaccatggctctgcgggtgggcagatggtgaggtgcttggcagaggggacc
ccgcttcctgatgtggaatggctggtttgcaaggacattaaaaagtgcagcaatgacacc
tcatgggctcttttgactaacaatatctctgacgtacacatggaagtccacctggatgag
aaaaacatggtggaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgcgg
tgtgtggcaaggaatgaccttggtgctgttactcgggaactgaagcttgtggctcccacc
ttgcgatcagaactaacggtggctgctgcagtcctagtgctgttagtgattgtgataatt
tcattgattgtcctggtcatcatatggaaacagaagccaaggtatgagataagatggaga
gtcattgagtccattagccctgatggccacgaatacatttatgtggacccaatgcagctg
ccttatgactccagatgggagtttcctcgagatgggttagtgcttggtcgaatccttggt
tccggtgcctttggaaaagtagttgaagggactgcatatggattgagtcgctctcaaccg
gtgatgaaagtagctgtgaaaatgctgaaacctacagctagatccagcgaaaaacaggca
ctcatgtctgaactgaagataatgacacaccttggcccccacctgaatattgtgaatctg
cttggagcttgtacaaaatcaggtcctatttacatcattactgaatactgcttttatggt
gatttggtgaactatctgcataagaacagggacaatttcctgaaccgacacccagagaag
ccaaagaaagatttggatatctttggaatgaacccagctgatgaaagcacaagaagttat
gtgatattatcatttgaaaacactggagaatacatggacatgaaacaagctgataccact
cagtatgtgccaatgctggaaaggaaggagggatccaaatactctgatattcagagatct
gtgtatgatcggcctgcttcatataagaagaagtctatgtcagaatcagaagtcaaaaac
cttctttcagatgacagttcagagggcctcagcctgctggatttgctgagcttcacctac
caggttgcacggggaatggaattcttggcttccaaaaattgtgtgcaccgtgacttggca
gctcgtaatgtcctcctggctcaaggaaaaattgtgaagatctgtgactttgggctggct
agagacatcatgcatgattccaattatgtctccaagggcagcactttcctcccagtaaaa
tggatggcaccagaaagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggaattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gtcgattctactttctacaataagattaagagtggataccgaatggccaaacctgatcat
gctaccaatgaagtgtatgagatcatggtgaagtgctggaacagtgaaccagagaaaaga
ccttctttttaccatttgagtgaaattgtggagagcttgttgcctggagagtacaaaaag
agctatgagaagattcacctggacttcctgaaaagtgatcacccagctgtcacccgcatg
agaggggactgtgacaatgcttacattggtgtcacctacaagaacgaagacaagctaaag
gaccgggagagtggatttgatgagcagaggctgagtgctgacagcgggtacatcatcccc
ctgcccgacattgaccctgtttctgaagatgagcttggcaaaaggaacaggcacagttcc
cagacatctgaagaaagtgctattgagactggttccagtagctctactttcatcaagaga
gaggatgagaccattgaggacattgacatgatggacgacattgggattgactcctcagac
ctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system