KEGG   Falco peregrinus (peregrine falcon): 101913718
Entry
101913718         CDS       T02856                                 

Gene name
LRP2
Definition
(RefSeq) LDL receptor related protein 2
  KO
K06233  low density lipoprotein-related protein 2
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101913718 (LRP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fpg04131]
    101913718 (LRP2)
Membrane trafficking [BR:fpg04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    101913718 (LRP2)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 cEGF SGL EGF_CA He_PIG
Other DBs
NCBI-GeneID: 101913718
NCBI-ProteinID: XP_005237189
LinkDB
Position
Un
AA seq 4655 aa
MDGRAATACKLLILFAACIMQGSCQGCERGQFRCGNGRCIPADWRCDGARDCSDDTDEAG
CPQPTCEGNQFQCQTDGECIPQSWVCDDEEDCEDGSDEHQQCPGRTCSSQQFTCSNGQCI
PSAYWCDRVKDCTDGTDERACHYPRCEQLSCANGACFNASQRCDGKVDCRDSSDEANCTH
GCTSTQFQCANGECIPRAFICDHDDDCGDRSDENSCTYATCRGNFFTCPSGRCIHQSWIC
DGDDDCEDNEDERGCESGHHECYPGEWACPGSGHCIPIGKVCDGAADCPAGEDETNITAG
RHCNISHCAALSCQYRCHSSPSGGMCYCPAGYTISSNDSRTCIDFDDCKMWGVCDQLCED
RVGHHRCHCVEGYFLEHHRHCRANTSAGVASIIFSNGRDLLIGDLHGRSFRTLVQSQNRG
VAVGVDFHFYLHRVFWTDTVQDKVFSVNIDGSDFQEVLNVSVDTPENIAVDWVNNKLYVV
ETSVNRIDMVNLDGTNRVTLIAENLGNPRGIALDPTVGYLFFSDWDSLSGDPKVERAFMD
GTNRQDLIKTKLGWPAGITLDIVSKRLYWVDSRFDYIETVTYDGLQRRTIAHGGSLIPHP
YGITLFEHNVYFTDWTKMAVVKANKFSESNPQVIYQSSLRPYGVTVYHAARQPYVRNPCG
SNNGGCEQICVLSHKTDNDGLGYRCRCTLGFDLHVDGRHCVAVQQFLLFSSQLAVRGIPF
NLSTQEDVIIPVTGSPSYFVGIDFCAQDDTIFFSDTSRDMIYKQKTDGSGREILTANRVE
SVEDLAFDWISKNLYWTDPRYRSISVMRLADRSRRAIVQNLNNPRSVVVHPVIGYIFWTD
WFRPAKIMRAWSDGSHALPIVNTTLGWPNGLAIDWSSLRLYWVDAFFDKIEHSTFDGLDR
RTLEHITQMTHPFGLTIFGGYAYFTDWRLGGIVRVRKSDGGEMTIIRRGISNIMHVKAYD
AHSQIGSNYCNRGTNPNGDCSHFCFPVPNFQRVCGCPYGMKLASNQLTCIEDPSNEPPTL
QCGSYSFSCGNGRCVPQYYQCDGVDDCHDNSDEQNCGSLNNTCASSAFTCASGQCIPGRW
RCDKHNDCFDGSDELHCPTQGPTSCPVTMFTCDNRRCIPRIWLCDTDNDCGDGSDEKNCT
FTGTCEPRQFQCPDHRCIDPFYVCDGDKDCMDGADERGCIYNCSATEFKCLSGDQCISTY
YQCDGVFDCNDHSDETDCPTRPPGMCHQNEFQCQSDGNCVPANWECDGHLDCADGSDEHH
RCPVRTCPPSLFHCDNGNCVYRAWICDGDNDCRDMSDERDCPTQPFRCPSWQWQCPGHSI
CVNLSKVCDNSADCPNGADESPLCNQESCSDNNAGCTHECIQGPFGAQCTCPIGYQLAND
SKTCEDINECDPPGFCSQHCYNERGSFRCYCDEGYVLETNEKTCKAAESGNLLLLVASRN
QIIVDNITSQSHSIYSLVRDGRNIVAIDFDSVTDRVFWSDTTQDKIWSAYQNGTGRKIVF
DSGVTVTESIAVDWVGRNLYWTDFVLETIEVSKMDGSHRTVLISENITNPRGLVLDPRTD
AHVMFWTDWGQNPRIEKASMDGKMRTVIINNKIYWPNGLSIDYPNKLLYFADAYLDYIDF
CDYNGNNRRQVVASDLILQHPHALTVFEDFVYWSDRYTNRVIRANKWHGGNQTVMIYNIH
QPLGLVVVHPVKQPSGINSCASSPCSHLCLLSSSGPLFFSCACPSGWILSPDSRNCMRVE
HPFLIAVRDNIIYGISLNPEEKTNDAMVPIAGVQNGVDVDFDDSEQMIYWIENPGEIHRV
RSDGGNRTVFAPAAVIGAPFGLALDWISANLYYSNPGTQSIEVLKLHGDVMYRKTLITND
GTSLGAGTPIGLTVDPARGKLYWTDQGTDTGVPAKIASANMDGSGIQTLFTGNLDHVEFI
TIDIKEQRLYWAVTSTGVIEKGNVDGTNRVTLVVHLSHPWGIAVYDTFLYYTDRDYEVIE
RVDKSTGANKVVLRDNVPRLKCLRVYYRDNSAGSSNGCNNNIGVCQQLCLPVPGGLFSCA
CATGFQLNPDNRTCSPYSSFVIVSMLSAIKGFSLETSDHSEAMVPLAGRGRNALHVDVHM
PSGFIYWCDFSSTISSQNAIRKIKPDGSYFRNVVTNGIGRNGIRGIAIDWVAGNLYFTNA
FLTETFIEVLRLNTTYRRVLLKTTIDMPRHIVVDPKNRYLFWADYGQNPKIERALLDCTN
RTVLVSEGIVTPRGLAIDHSNGYIYWVDDSLDMIARIQPDGGDVEIVRYGSRYPTPYGIT
VFGNSIIWVDRNLKKVFQASKEPGNTDQPTVIRDNINWLRDVTIYNSHFQSRSPLDVNNN
PCLDNNGGCSHLCFALPDMQMPKCGCAFGTLGSDGKSCSISTDDYLIFALENALRSIHLD
PENHSPPFRTVNVLRTAVALDFDSINNRIYFTQSYPSGTGRISYVSIYSGIGSPTVVASD
LGTPDGIAFDWINNRVYYSDYLNQTISSMAVDGSNRTVIARVPRPRAVVLDPCRGYMYWT
DWSSNAKIERATLGGNFRTPIVSTNLVWPNGLTLDYEEQQLYWADANLQKIERCTLTGTN
REVIVSTALHPFAMTLFDQHIYWTDWNTRSIYRANKYDGSDQIVMIMNLPQRPMDIHVWA
KSKQQQCTNPCNQFNGGCSHICAPGPAGAECQCPSEGRWYLANNNKHCIVDNGTRCDTGF
FTCLNGQCISERWKCDNDNDCGDGSDELESVCAFHTCQPTAFTCGNGRCVPYHYRCDHYN
DCGDNSDEAGCLFRTCDSHTEFTCNNGRCISLQYVCNGVNNCYDNGTSDERNCPERTCQS
GFTKCQSTNICIPRTYLCDGDNDCGDMSDESPTHCVSLTCTNSEFRCTSGRCIPAHWYCD
QGIDCADGSDEPASCVPQMRTCSSDQFRCDDGRCIPATWICDGDNDCGDMSDEDQRHNCA
NRNCTAAEFTCANNRPPLRRCIPRAWICDGDADCSDAFDEHQNCTRRSCTENEFTCSNGL
CIRNTYRCDRRNDCGDSSDERGCIYEPCQQHQFTCQNGRCISKAYVCDGDNDCGDESDEL
EHLCRTPEPTCPPHHFKCDNGNCIEMVKVCNRLDDCLDNSDEKGCGINECSDPSISGCDH
DCTDTQTSFYCSCHPGYKLMSDKRTCDDIDECNETPSVCSQICENTAGSYICKCAPGYIR
EPDGKSCRQNSNISPYLIFSNRYYLRNLTADGQSYSLILQGLRNVVALDFDRVEKRLYWI
DVGRKVIERMFLNGTNKEAVISDDVPNGEGIAVDWVGRKLYWVDAYKDCLYVSELDGRFR
KKLVDQCVDANNTFCFQYPRAIVVHPKYGQIYWTDWADRAYIGRAGMDGKEKTVIISTKL
EWPNGLTIDYTNDKLYWADAHLNYIEYSDLDGHHRHVVYDGTLPHPFAITIFEDTIYWTD
WNTRTVEKGNKYDGSDRTVLVNTTHRPFDIHVYHPYRQPFVNNPCGTNNGGCSHLCLIKA
GGQGYSCECPDNFMIVQFGNTAHCLPMCSSTQFLCADTERCIPIWWKCDGQRDCRDGSDE
PPTCPHRYCPVGQFQCNDGNCTSPHFLCNTQPDCHDRSDEDPVLCANHQCETHQWQCANK
RCIPEAWQCDREDDCGDNSDEDSTHCASRTCPPGQFKCDNGHCIPQSWKCDVDDDCGDNS
DEPFHECMGPAYRCDNHTQFSCRTNYRCIPLWAVCNGNDDCRDNSDEQGCEEMTCSPFGD
FRCDNHRCIPLRWKCDGDNDCGDNSDEHKCSPRECTESEYRCDNLRCIPSRWICDHDDDC
EDNSDERDCELRTCHPGYFQCDSGHCVAERFRCDGNADCLDFSDEATCPTRYPNGTYCPP
MLFECKNHVCIQPYWKCDGDNDCGDDSDEELHLCLDIACDSPFRFRCENNRCIYSHELCN
QEDDCGDGSDEKEEHCREPTPRPCTTEEFKCSNGNCIPLHYVCDNYDDCGDHFDEMGCNP
GTERTCAENICEHNCTNLNEGGFICSCRPGYKASETNRNSCDDINECEIFGTCTQDCKNS
KGSYECFCADGFRSVGDQQGKQCAANGNPPLLLLPDNVRIRRYNISSEQYSDYIDNQERI
QALDYDWDPEGIGLSIVYFSILGQGSEFGAIKRAYLPTFDSSRNNPTKEVDLNLKYIVNP
DGLAVDWVGRHLYWTDSGTNRIEVAKLDGRYRKWLIFSLLDQPAAIAVNPKRGLMYWTDW
GRQPKIECAWMDGQQRQTLVSEDLGWPTGLSIDYLNNDRIYWSDSKENIIESMRPDGTDR
TIVLHGVSSPYSLDVFEGHLYWIAKERGEVWKKDKFGNGEKVKVLTVNPWLTQVRIYHQH
RYNQSVPNPCKDVCSHLCLLRPGGYTCTCPQGTRFIEGSSTECDAAIESPPTMPPACRCM
YGGTCYIDESGLPKCKCSYGYTGNYCEIGLSKGVPPGTTAVAVLLTVILIIIIGVLAVGG
FFNYRRTGSLLPALPKLPSLSSLVKSTENGNGVTFRSGADVSMDIGVSGFGGDSAIDRAM
QMNENFAVESGKQPITFENPMYATRDGGASRASAVTVVRPTHVAAVGSEENENFENPVYA
SVISASPKEPPQGTDVPRESKWSFFKRRMKQNTNFENPIYAEMEKEQQQDTENVPTPSPS
LPSKITLKRDQPLAYTATEDTFKDTANLVKEDSVV
NT seq 13968 nt   +upstreamnt  +downstreamnt
atggatggaagagcagcaactgcttgcaaactgctcatattattcgctgcatgcataatg
cagggcagttgccaaggatgtgagcgggggcagtttcgctgtggaaatggccgctgtatt
cctgcagattggaggtgtgatggggctagagactgctcagatgatacagatgaagctggc
tgtccacaacctacctgtgagggaaatcagtttcagtgtcagactgatggtgaatgcatc
ccccagtcatgggtttgtgatgatgaggaggactgtgaagatggctcagatgagcatcaa
caatgtccgggaaggacatgctcaagtcagcagttcacatgttcaaatggacagtgtatc
ccaagtgcatactggtgcgatcgagtaaaggactgcactgatggaacagatgaaagagcc
tgccactacccaagatgtgaacagttatcatgtgcaaatggagcatgttttaatgcaagt
cagcgatgtgatggcaaagttgattgcagagattcttctgatgaagctaattgcacacat
ggatgtaccagtacgcagtttcagtgtgccaatggagaatgcatcccacgagcctttatc
tgtgaccatgatgatgactgtggagacaggagtgatgagaactcttgcacttatgcaact
tgcagaggcaacttcttcacttgcccaagtggccgttgcattcatcagagctggatatgt
gatggagatgatgattgtgaagataacgaagatgaaagaggatgtgaaagtggtcatcac
gaatgttacccaggagagtgggcctgccctgggtcagggcattgcattccgattgggaaa
gtgtgtgatggggctgcagactgccctgcaggagaagatgaaactaacatcactgcggga
agacattgcaacatatcacactgtgctgctttgagttgccagtatcgctgtcattcttct
ccatcaggagggatgtgttattgtcctgcaggatatacaataagtagcaatgacagtcgt
acttgtattgattttgatgactgcaaaatgtggggtgtctgtgaccagctgtgcgaagat
cgtgtggggcatcaccggtgccactgcgtggaaggttatttcctagagcatcatcgccat
tgtcgagccaacacttcagctggtgttgcgtcaattattttttccaatggccgtgatcta
ctgattggagatcttcacggaagaagttttcgtactttggtgcagtcgcagaatcgtggg
gttgcagttggagtggactttcacttttacctgcacagagtcttttggactgatacagtg
caagataaggttttttctgttaatattgatggctctgatttccaagaagttttaaatgtt
tcagttgacacacctgaaaatatagcagtggattgggttaacaataaactgtatgtggtc
gagaccagtgtaaacagaatagatatggttaacttggatggaacaaaccgtgtgactctt
attgctgaaaatcttggaaatcctagaggaatagcacttgatccaactgttggctacttg
tttttctcagactgggatagtctgtctggtgatcctaaggtggaaagggcctttatggat
ggcacaaaccgtcaggatttgataaaaacaaaattaggttggcctgctggaataactctg
gatattgtatcaaagagactttattgggttgacagccgatttgattacattgagactgta
acttatgatgggcttcaaaggagaacaatagctcatggaggctcactgattcctcatcca
tatggaatcactttatttgaacacaatgtttatttcactgattggaccaaaatggcagtt
gtgaaagctaacaagttttcggaatctaaccctcaagtgatctaccagtcttcactgaga
ccttacggagtgacagtttaccatgctgccaggcagccatatgtaagaaatccttgtgga
agtaataatgggggatgtgaacagatctgtgttctcagccacaaaacagataatgatgga
ctaggttatcgctgtagatgtacactgggctttgatctacatgtagatggacgacattgt
gttgctgtgcagcagttcctgctgttttcatctcagctggcagtgcgggggatcccattc
aatctctccacccaggaagatgtgatcatacctgtaacagggagcccttcatactttgtt
ggaattgacttctgtgctcaggatgacaccatttttttttcagacacaagtagagacatg
atctataaacagaaaactgatggttcaggacgagaaatcctgacggctaatagagtggaa
agtgttgaagatttggcctttgactggatctcaaagaatctatactggacagaccctcga
tacaggagcattagtgtaatgaggctggcagatagatctaggagagctattgttcagaat
ttaaacaatcctcgatcagtagtggttcatcctgttattgggtatatattctggacagat
tggttccgtcctgcaaaaatcatgagggcctggagtgatgggtcccatgccttgccaatt
gtgaatacaacgctaggctggcctaatggcctagccattgactggagttctctaaggctg
tactgggtggatgctttttttgataaaatcgagcatagcacctttgatggactggacaga
cggactcttgaacatattacacagatgactcacccatttggccttactatttttggaggt
tatgcttatttcactgattggagacttggtggaatagttcgagtgaggaagtccgatgga
ggagaaatgactattattaggaggggcattagtaacattatgcatgttaaagcatatgat
gctcactcccaaataggctctaactactgtaatagaggaacaaatcctaatggagactgc
agccatttctgcttcccagtaccaaattttcagagagtttgtggttgtccttatggcatg
aagctggcttcaaatcagttgacatgtattgaagatccatccaatgagccacccactttg
cagtgtggctcctactcattttcgtgtggtaatggaagatgtgtgcctcaatactatcag
tgtgatggtgttgatgattgccatgataacagcgatgaacaaaattgtggttctttaaac
aatacctgtgcttcatcagcttttacctgtgccagtggtcagtgtattccaggtcgctgg
cgttgcgataaacataatgactgttttgatggcagtgatgaattgcattgtcctacacaa
ggacccacttcatgccctgtaaccatgttcacctgtgataacagaagatgtattcctagg
atctggctatgtgatactgataatgattgtggtgatgggtcagatgaaaaaaactgcact
ttcacaggtacttgtgaacccaggcaatttcagtgtccggatcatcgctgtattgaccca
ttctatgtttgtgatggagataaagattgtatggatggtgctgatgagcgtggctgcata
tataactgcagtgccacagagtttaaatgtctaagcggagaccagtgtatcagcacttat
taccagtgtgatggtgtttttgactgtaatgatcactcagatgagactgattgccctaca
agaccaccagggatgtgccaccagaatgaattccagtgtcaatcagatggcaattgtgtt
cctgctaactgggaatgtgatggccatcttgactgtgcagatggctcagatgaacatcat
agatgtcctgtcaggacctgtcctccatctctatttcactgtgataatggcaactgtgtc
tatcgagcatggatctgtgatggtgataatgactgcagagatatgagtgatgagagagac
tgccctactcaacctttccggtgccccagctggcagtggcaatgtccaggtcacagtatc
tgtgtgaatctgagcaaagtatgtgataattctgccgattgtccgaatggagctgacgaa
tccccattgtgcaatcaggagagctgctctgacaataatgctggctgcactcatgaatgt
attcaaggaccttttggagctcagtgtacctgtcctattggataccagcttgcaaatgac
tctaagacttgtgaagatattaatgaatgtgaccctccaggcttttgtagtcagcattgt
tacaatgagagagggtcttttaggtgttactgtgatgaaggatacgttctagaaaccaat
gagaagacttgtaaagcagcagagtctgggaatcttcttttgcttgtggcaagtcgtaac
caaatcattgtggacaacatcacctctcagtcacacagtatttattctttggttcgggat
gggaggaatattgtggctattgattttgattcagtcacagatcgtgtcttttggtctgat
acaacacaagataaaatttggagtgcttatcagaatgggactggccgaaaaatagtgttt
gacagtggtgtcaccgtgactgaaagtatagcagtagattgggtaggtcgcaatctttac
tggacagactttgttctggaaacaattgaagtctctaaaatggatgggagccacaggacc
gtgctgattagtgaaaatataacaaacccaaggggactagtgttagatcccagaactgat
gctcatgtaatgttctggactgactggggccaaaaccctcgaattgaaaaagccagcatg
gatggcaaaatgcgaacagtgattattaacaacaaaatctactggcctaatggactctcc
attgattacccaaataaacttctctattttgctgatgcttatcttgattatattgatttt
tgtgattacaatggaaacaacagacgacaggtggttgcaagtgatctgatactgcagcat
ccacatgctttaactgtctttgaagattttgtgtactggagtgaccgctatactaatcgc
gtaattcgggccaataaatggcatggaggaaaccagacagttatgatttataacattcac
cagcctttggggcttgtggtagtccatcctgtaaagcaacctagtggtatcaattcttgt
gcatcatccccctgtagccacctctgcttgctttcttcatctggaccgctttttttttcc
tgtgcttgtccttcaggatggattctttctcctgacagcaggaactgcatgagagttgaa
caccctttccttattgctgtaagagataatataatttatggaatttctttgaaccctgag
gagaagacgaatgatgctatggttccaatagcaggagttcagaatggtgttgatgttgac
tttgatgactctgaacagatgatttattggattgaaaatccgggtgaaattcaccgagtg
aggtcagatggaggcaacaggacagtttttgctccagcagctgttatcggtgctcctttt
ggtctggcattggactggatatctgcaaacctgtattacagtaacccagggacacagtca
attgaggtcctgaagctgcatggtgacgtaatgtacaggaaaacactgattaccaatgat
ggcacctctctgggagctggcacaccaattggtttgacagttgatccagcaagagggaag
ctgtactggacagaccagggaactgacactggagtcccagcaaagattgccagtgcaaac
atggatggatcaggcatacaaaccctcttcactggcaaccttgaccatgtagagttcatt
accattgacattaaggaacaaaggttgtactgggctgtcacaagcacaggagtgattgag
aaaggcaatgtggatggtacaaatcgtgtgactctggtggttcatctttctcatccatgg
ggaattgctgtgtatgatacctttctgtactatactgatcgagattatgaagttattgaa
cgagttgacaagtccactggagcaaacaaagtagtactgagagataatgtcccaagactg
aagtgcctacgtgtgtattacagagacaattctgctggttcctcaaatggctgcaataac
aatattggagtttgccagcagctttgcctgcctgtacctggtggattattctcctgtgcc
tgtgctactggctttcagctaaatcctgataacagaacctgttccccgtacagttcattt
gtaattgtttctatgctttctgcaattaaaggatttagtttagagacatctgatcactct
gaagccatggtaccactggcaggaagagggcgaaatgcacttcatgtggacgttcacatg
ccttctggtttcatttactggtgtgacttcagtagcacaatttcttctcagaatgcaata
cgtaaaattaaacctgatggttcttattttagaaatgttgttacaaatggaataggacga
aatgggatccgtggcattgcaattgactgggtagcaggaaatctgtattttacaaatgca
ttcctgacagagacttttatagaagttttgcgtttaaacacaacttatcgccgtgttctg
cttaaaactaccatagatatgccaaggcacatagtagtcgacccaaaaaacaggtacctg
ttctgggcagattatgggcaaaatcccaagatcgaacgtgcacttcttgactgcaccaac
agaacagttcttgtgtctgagggcattgtcacacctcgtgggctggccatagatcacagc
aatggatacatttactgggtggatgattccttagatatgattgcaagaattcagcctgat
ggtggtgatgttgaaattgtgcgttatggcagtcgctatccaactccatatggtatcact
gtctttggaaattctatcatctgggtggatcggaacctgaaaaaagtcttccaggccagc
aaggagccagggaatactgatcagccaacagtaatacgagacaacattaattggctaagg
gatgttaccatttacaacagtcatttccagtcacgttcaccccttgatgtcaacaacaat
ccttgtttggacaacaacggaggctgttctcatctgtgttttgccctgcctgacatgcag
atgcccaaatgtggttgtgcctttggaacactaggcagtgatggcaagagttgttccatt
tcaactgacgattacctgatttttgctcttgagaatgccctcagaagtatccacctagat
cctgaaaatcacagtcctcccttccgcacagtcaatgtgttaagaactgcagtggccctg
gattttgacagcataaacaacagaatatattttacgcaaagttatccttcagggacagga
agaataagttatgttagtatttactcaggaattggctctccaacagtagttgcatctgac
ctggggactccagatggcatagcctttgactggatcaacaacagagtttactacagtgac
tacctcaatcagactatcagctcaatggctgtggatggatctaaccgtacagtgattgcc
cgggttccacgacccagagccgttgtattagatccctgcagagggtatatgtactggact
gactggagttcaaatgcaaagatagaacgagccacgcttggaggaaacttcagaacgcct
attgtgagcaccaatttggtatggccaaatgggcttaccctggactatgaagaacagcag
ctatactgggctgatgcaaatctgcagaagattgagcggtgcactctcactggtacgaat
cgggaggtaattgttagcactgctttgcatccgtttgcgatgacattgtttgatcagcac
atatattggacagactggaacacaagaagcatttaccgagctaataagtatgatggttca
gatcagattgtaatgatcatgaatcttccacaaagaccaatggatattcacgtctgggca
aaaagcaagcagcaacagtgtactaacccttgcaaccagttcaatggtggctgcagtcac
atctgtgcaccaggtccagctggtgcagaatgtcagtgcccctctgaaggtcgctggtat
ttagctaataataacaagcactgtattgtggataatggtaccaggtgtgatactggtttc
ttcacatgtcttaacgggcagtgtatctctgagcgatggaaatgcgacaatgacaatgat
tgtggtgatggcagtgatgagttggaaagtgtgtgtgctttccatacttgtcagcccaca
gcttttacctgtggtaatgggcgatgtgtaccctatcattaccgctgtgatcactacaat
gactgtggagataacagtgatgaggctggctgcttgttccgaacttgtgactcccacaca
gaatttacttgcaataatggaaggtgtatatctcttcagtatgtctgcaatggagtaaac
aactgttacgataatggcacatcagatgagagaaattgcccggagcgcacttgccagtcc
ggttttacaaaatgtcaaagcacgaatatttgcattcctcgaacatatttgtgtgatggt
gataacgactgtggagatatgagtgatgagagccctactcactgtgtctcactgacttgc
acaaatagtgaatttcgttgtacatcggggcgttgtattcctgctcattggtactgtgat
caaggaatagactgtgctgatggctctgatgaacctgcctcttgtgtgccccaaatgcgg
acttgttcaagtgaccagttcagatgtgacgatggaagatgtatcccagcaacatggatc
tgtgatggtgataatgactgtggggatatgagtgatgaggatcaaagacataattgtgca
aatcgcaactgtacagcagcagagttcacatgcgccaacaatcgacccccactcaggagg
tgcattcctcgggcatggatctgtgatggtgacgctgactgcagtgatgcatttgatgaa
caccagaactgcacaagaagatcttgcacagaaaatgagtttacttgtagtaatggcttg
tgcatacgaaacacttacagatgtgacaggcggaatgactgtggtgatagcagtgatgaa
aggggatgcatttatgaaccatgtcaacagcaccagtttacttgtcagaatgggcgctgc
atttccaaggcctatgtctgtgatggcgataacgactgtggtgatgaatctgatgagctg
gaacatctctgtagaacaccagaaccaacctgccctccccatcattttaaatgtgacaat
ggaaactgcattgaaatggttaaagtctgcaatcggttggatgattgcttagataatagc
gatgaaaaaggatgtggtataaatgaatgcagtgacccttcaatcagtggatgtgatcat
gactgtacggacacacagacaagtttctactgttcttgtcatcctggatacaaacttatg
tctgataaacggacttgtgatgatattgatgagtgcaatgaaactccatcagtatgtagc
cagatttgtgagaacacagctggctcctacatctgtaagtgtgccccaggctatatccgg
gagcctgatggaaaaagttgccggcaaaatagtaatatctccccataccttatttttagc
aaccgttactatctgagaaatctcacagcagatggtcagtcttactctctcattttgcaa
ggactgagaaatgtggtggcactggactttgacagggtggaaaagaggttgtactggatt
gatgtggggaggaaggtcattgaacgaatgttcctaaatggaacaaataaggaggcagtg
ataagtgatgatgtacccaacggggaaggtatcgctgttgactgggttggcagaaaattg
tactgggtggatgcctacaaagattgtctctatgtctctgaacttgatggaagattccgg
aaaaaactggtggatcagtgtgtagatgccaacaacactttctgctttcagtaccccaga
gcaattgtggttcatccaaaatatgggcaaatctactggacagactgggcagatcgagcc
tatattggacgagcaggcatggatggcaaggagaagacagtaattatctctacaaagtta
gagtggcccaatggactcaccatagattacaccaatgacaagctgtactgggcagatgcc
catctaaattacattgaatactctgacctggatggacatcatcgtcatgtggtatatgat
ggcactttacctcatccgtttgcaataacaatttttgaagacacaatatattggactgac
tggaacacaagaacagttgaaaagggaaataaatatgatggatcagacaggactgttctt
gtgaacaccacacacaggccatttgacatccatgtttaccatccatacagacagccattt
gttaataatccttgtggcaccaacaatggtggttgttcccatctttgtctaataaaagct
ggtggtcagggttattcctgtgaatgtcccgataacttcatgatagtacagtttggcaat
acagcccactgccttccaatgtgctctagcacccagtttctctgtgcagacactgagagg
tgtattcctatctggtggaaatgtgatgggcagagggactgtcgagatggctctgatgag
ccccctacctgtccgcaccgatactgtccggttggtcagtttcagtgtaatgatgggaac
tgcacaagtccacatttcctgtgtaatacccagccagattgccatgacagatcagatgaa
gatcctgtactttgtgctaatcaccagtgtgaaactcatcagtggcagtgtgccaataaa
cgatgtatcccagaagcctggcagtgtgacagagaggatgactgtggtgacaactcagat
gaagatagtactcactgtgccagtagaacctgtcctccaggccaatttaaatgtgataat
ggccattgcatcccacagtcctggaaatgtgatgtggatgatgattgtggtgataactct
gatgagccattccatgaatgcatgggcccggcctatcggtgtgacaatcatacgcaattc
agctgtagaaccaactaccgttgcataccactgtgggcagtgtgcaatgggaatgatgac
tgcagagacaacagtgatgaacaaggctgtgaggagatgacttgcagtccttttggagat
ttccgttgtgacaaccatcgatgtatcccactgcgctggaagtgtgatggagataatgac
tgtggagataactctgatgagcacaaatgcagtcctcgtgaatgcacagaaagtgaatac
cgttgtgacaatttgcgctgcataccttcccggtggatctgtgatcatgatgatgactgt
gaagacaattcagatgaacgtgactgtgagctgaggacctgccacccaggttatttccag
tgtgatagtgggcactgtgttgcagagcgcttcagatgtgatggaaacgcggactgcctt
gatttctccgatgaagcaacttgtccaacacggtatcctaatggtacatactgtccgccc
atgctgtttgaatgtaaaaaccatgtctgtatccagccatactggaaatgtgatggtgac
aatgactgtggagatgactctgatgaagaacttcacctttgcttggacattgcttgtgat
tctccattccgtttccgatgtgaaaacaaccgctgtatatatagtcatgagctgtgcaac
caggaggatgactgtggagatggaagtgatgagaaagaggaacactgtagagaaccaacc
ccaagaccttgtacaactgaagaattcaagtgcagtaatggaaattgcattcctctacat
tatgtttgtgacaattatgacgactgtggagaccattttgatgaaatgggctgcaatcct
ggaacagagcgaacttgtgcagaaaatatctgtgaacataactgtaccaacctgaatgaa
ggaggctttatctgttcctgtagaccagggtacaaggccagtgaaactaaccgaaactcc
tgtgatgatattaatgagtgtgagatctttgggacatgcacccaggactgcaagaattcc
aaaggaagctatgaatgtttctgtgcagatggcttcaggtctgtgggtgatcaacaaggg
aaacagtgtgcagctaatggtaatcctccattgttgctgctgccagataatgtgcggatt
cgaagatacaatatttcatcagaacagtactctgactatattgataaccaggagcgcatc
caagctctggattatgactgggaccctgaagggataggcctgagtattgtgtacttcagc
attctgggacagggttctgagtttggagccatcaaacgtgcttatctgcccacatttgac
agcagtaggaacaatcctacaaaggaagttgacttgaatctcaagtacatagttaatcct
gatgggttagctgttgactgggttggaagacatctttactggactgattcagggactaat
cgcatagaggtggcaaaattagatggacggtacagaaagtggcttatcttttctctactg
gatcaaccagcagctattgctgtcaatccaaaacgtgggctcatgtattggactgactgg
ggaaggcagccaaagattgaatgtgcctggatggatggacaacaaagacaaactctggtc
tctgaagaccttggctggccaacaggtctttctattgattatttgaacaatgacaggatc
tattggagtgattctaaagaaaatattattgaatccatgagacctgatgggacagacaga
accatagtattacatggagtaagcagtccatacagcctcgatgtctttgaaggccattta
tattggatagctaaagaacgaggagaagtctggaagaaagataaatttggaaatggagaa
aaagtgaaagtgctgactgtaaatccatggcttactcaggtgcgcatctatcaccagcac
agatacaatcaatcagtgcctaatccttgtaaagatgtctgcagccacctctgcttgctg
agaccaggaggatacacctgcacttgtcctcaagggactcgattcatagaaggcagcagc
acagagtgtgatgcagccattgaatcccctcccacaatgccaccagcatgcaggtgcatg
tatggaggaacatgctatatagatgaaagtggtcttccgaaatgcaagtgttcatatggc
tacactggcaattattgtgaaataggattgtcaaaaggagtgcctcctggaacaacagca
gtagcagtattgctgactgtcatactaatcataataattggagtgttagcggttggaggc
ttctttaactacagacgaactggttcccttttaccagcgcttcccaaactaccaagttta
agcagtcttgtaaaatctactgaaaatggcaatggggtaactttccgatctggagcagat
gtgagtatggacataggagtgtctggctttggaggagactctgctatagacagagcaatg
caaatgaatgaaaactttgcagtggagtcagggaaacagccgatcacatttgaaaatcca
atgtatgcaaccagagatggtggagccagcagagccagtgcagttacagtcgttcggcca
acacatgtagcagcagttggtagtgaagaaaatgaaaattttgaaaaccctgtgtatgcc
tctgtgatatctgctagtccgaaggaaccccctcagggtacagatgtacctcgggaatca
aaatggagtttcttcaagagaagaatgaaacaaaacactaattttgaaaacccgatatat
gcagagatggaaaaggaacagcaacaagacacggaaaatgttcctaccccttctccttcg
ctgccatccaagattactctgaagagagaccaaccattagcttatacagcaacagaggat
acatttaaagacaccgccaatcttgttaaagaggactctgtagtataa

KEGG   Falco peregrinus (peregrine falcon): 101924263
Entry
101924263         CDS       T02856                                 

Gene name
BOC
Definition
(RefSeq) BOC cell adhesion associated, oncogene regulated
  KO
K20020  brother of CDO
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101924263 (BOC)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig ISET-FN3_linker V-set Pur_ac_phosph_N C2-set_2 Ig_4 Ig_5 C1-set
Other DBs
NCBI-GeneID: 101924263
NCBI-ProteinID: XP_013152266
LinkDB
Position
Un
AA seq 1145 aa
MAMPSSNMANVSGRGCETVGSPLLSPYGILPWAPQDTLHGMAMTRGKKRPMSPIPCFILA
AASCFAKLSESLQVTVQPASIVQKLGGPVSLGCVVDPPRVNLTWRLNGKELAGSDEVLGI
RIKQGKLVITALNNHTVGRYQCIARVPEGVIASVPAVVTLANLKDFKFDGQHVIEVDEGN
TAVIACDLPESHPKAQVRYSVKQEWLEASRDNYLIMPSGNLQIVNASQEDEGTYKCAAYN
PVTQEVKTSVSSERLRVRRSTAEAARIIYPPEAQTIIVTKGQSLILECVASGIPPPRVTW
AKDGSSVSAYNKTRFLLSNLLIDPTSEEDSGTYSCTADNGVGEARAAFIFYNVQVFEPPE
VTMELSQQIIPWGQSAKFTCEVRGNPQPSVMWLRNAVPLSASHRLRLSRKALRLVSVGPE
DDGIYQCMAENEVGSAQAMVQLRTARPGATLDPGRDAQLGSAQPPTPPSRDSALKLLLDK
AGLPKPATTPLAASPQCAANRELVSPAEAPIILSSPRTSKTDSYDLVWRPRPDSRAPILY
YVVKHRKVTNASDSWAVRDVPASQHRLTLTRLDPGSLYEVEMAAHNCAGEGQTAMVTFRT
GRRPKPEIVASKEQQIQRDDPGTSTQSSNQSDNSRLSPPEAPDRPTISMASETSVYVTWI
PRGNGGFPIQSFRVEYKKLKKLGDWVLATSDIPPSRLSVEIPGLEKGTSYKFRVRALNIL
GESEPSAASRPYVVSGYSNRVYERPVAGPYITFTDAINETTIMLKWMYIPASNNNTPIHG
FYIYYRPTDSDNDSDYKKDVVEGDRYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMIC
ETKARKSLGLPGRLPPSTVPPQQHPPLSGGHSGLGTGAMVARSSDLPYLIVGVVLGSIVL
LIVAFIPFCLWRAWSKQKQTIDMGFPGAGLLVSSCQYTMVPLRGISAPRASGHPYVNGQP
YANGAHLNGICPSAGVGYASTETRDYSPDEVPPSHEETNALLQARVLQNGNAQQDYQPSR
LPNSRTEDSSFLYSLPDDSTHHLLQPQDDCPHLQEHFVGLHHPVMGNKVGGPSLDARRDP
LFHQGSPCCLGLVPVEEVERLDCCQSRGDLHPQNPVITSLGQDLPRHLNSSPPSLRPLET
HSPTS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atggctatgcccagtagcaacatggccaatgtctcaggaagaggctgtgaaactgtggga
tcacctctgctctcaccttatgggatccttccctgggcaccccaggacacactgcatggg
atggcaatgacacgtggaaagaagagacccatgtcccccatcccttgcttcatcctcgca
gcagctagctgttttgccaaactgagtgaatctctgcaggtcacagtgcaacctgcctcc
attgtccaaaagcttgggggcccagtcagcctggggtgtgttgtggacccccctcgagtg
aacctcacctggagactgaacgggaaggagctggctggttcagatgaggtgctgggtatc
cgtatcaagcaggggaaacttgtcatcacagctctcaataaccacaccgtggggcgatac
cagtgcattgctcgtgtgcctgaaggagtcattgccagtgtccctgcagtggtcacgtta
gctaatctcaaagatttcaagttcgacggccagcacgtgatcgaggtggatgaagggaac
acggctgtgatcgcctgtgacctgcctgaaagtcatcccaaggctcaggtccgctacagc
gtgaagcaggagtggctagaggcctcccgagacaattaccttatcatgccatctgggaac
cttcagatcgtcaatgccagccaagaggatgaggggacttacaaatgcgctgcctacaac
cccgtgacgcaggaggtgaaaacctcggtctccagtgaaaggctccgtgtgagacgctcc
acagcagaggcagcccggataatctaccctcctgaagctcaaaccatcattgtcaccaag
ggccaaagcctcatcctggagtgcgtggccagcgggatccccccaccgcgggtcacctgg
gccaaggatggctccagcgtctccgcctacaacaagacgcgcttcctgctcagcaacctc
ctgattgaccccacgagtgaggaggactcgggcacctacagctgcacagctgacaacggg
gttggagaggccagagctgcgttcatcttctacaacgtgcaggtgtttgagcccccggag
gtcaccatggagctgtcccagcagatcattccctggggccagagtgccaagttcacttgc
gaggtgcgaggcaatccccagccctccgtcatgtggctgcgtaacgccgtccccctctcc
gccagccaccggctccggctttcccgcaaggcgctgcggctggtcagcgtggggcccgag
gacgacggcatataccagtgcatggcagagaacgaggtcggcagcgcgcaagccatggtg
caattgaggacagcccggccaggagctacactcgaccctgggcgagatgcccagctgggc
tcggctcagcctccaacaccaccttccagggacagcgccttaaagctgctcctggataaa
gctggactgccaaagcctgcgacgaccccgctggcagcatctccacagtgtgcagccaac
agggagctggtgtctccagctgaggcccccatcatcctcagctctccccggacatccaag
acagacagctatgatctggtgtggagaccccggcctgacagcagagcccccatcctctat
tatgtggtgaagcatcgcaaggtcaccaacgcctcggacagctgggcagtgagggacgtc
ccagcctcgcagcaccgtctgacccttaccaggctggaccctggaagcctctacgaggtg
gagatggctgctcacaactgtgccggcgagggacagacggccatggtgaccttccggact
ggccggcgcccaaaaccagagattgttgccagcaaagagcagcagatccagagggatgac
ccaggcacgagcactcagagcagtaaccagtcggacaacagccgtctgtcccctccagag
gcaccagaccgtccaaccatctccatggcatcagagacatctgtgtatgtgacttggatc
ccccgggggaatggcgggttccccatccagtctttccgcgtggaatataagaaattgaag
aagttgggagactgggtcctggccaccagtgacattcctccttctcgcctctcagtggaa
atcccaggcctggagaaaggcacatcctataaattccgtgtccgggcactgaacatcctg
ggagagagtgagcccagcgcagcatctcggccatacgtagtgtctgggtacagcaaccgc
gtctacgagcgccctgtggctgggccatacatcaccttcacagatgccatcaacgagacc
accatcatgctgaagtggatgtatatcccagccagcaacaacaacactcccatccacggc
ttttacatctactaccgccccactgacagtgacaatgacagtgactacaagaaggacgtg
gtggaaggagatcggtactggcactccatcagccacctgcagccagagacctcgtatgac
attaagatgcagtgcttcaatgaggggggggaaagcgagttcagcaacgtgatgatctgt
gaaactaaagctcggaagtctcttggtctgccaggtcgtcttccaccctccacagtgccc
ccccagcagcatcccccactcagtggtgggcacagtggcctggggacaggagccatggtg
gcccgttccagtgacttgccatacttgattgtcggcgttgtgctgggctctatcgtactc
ctcatcgtggctttcatccccttttgtctttggagagcctggtccaagcagaagcaaacc
attgacatggggttcccaggagccgggctgctggtatcgtcctgccagtacaccatggtg
cctctgaggggcatctctgctcctcgtgccagtgggcatccctatgttaacgggcagccc
tacgccaacggggcacacctgaatggcatctgcccctctgcaggagtggggtatgcgagc
accgagacccgagattacagtccagatgaagtgccaccgtcacacgaggagaccaacgcc
ttgctgcaggcgagagtgctgcaaaatgggaatgcccagcaagactaccagccctccaga
ttgcccaactcaagaacagaagacagctctttcctctacagtcttccagatgactccact
caccaccttcttcagccacaagacgactgtcctcaccttcaagagcactttgttggcctc
catcatccagtgatgggcaacaaagtaggaggccccagcctggatgctcgacgggatccc
ctgttccaccaaggaagcccttgctgcctaggcctagtgccagttgaagaggtagaaaga
ctagactgctgccagtccagaggagatctccatccccagaatccagtgatcacatctttg
ggtcaggatctaccaagacatctgaacagcagcccgccatcactgaggcccctagagact
cattctcccaccagctag

KEGG   Falco peregrinus (peregrine falcon): 101924476
Entry
101924476         CDS       T02856                                 

Gene name
CDON
Definition
(RefSeq) cell adhesion associated, oncogene regulated
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101924476 (CDON)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Pur_ac_phosph_N Tissue_fac EphA2_TM
Other DBs
NCBI-GeneID: 101924476
NCBI-ProteinID: XP_005242978
LinkDB
Position
Un
AA seq 1257 aa
MHPAPGLLQALLFITAVGLISATSSGLTPRFISEPLSAVQKSGGPVQLHCSAEPSMARLS
WLFNGEPLESKVGEVEIQSGSLTIVSLSLSTSGRYQCVANSSVGAVVSRPAMVSIGRLAN
FDMSVKPVVAAEEGGTAFIGCKVPDSNPKAQVRFQVQGKWLEQSTDNYLILPSGNLQILN
VSLEDKGSYKCAAYNPVTHDLRIELTGRKLIVTRSSSGSFHILHPLVPQSLAVPQHSSLM
LECIVSGLPPSSVRWVKDGRDVLSKGRWKLLHSHLVTDRLEASDSGNYSCMVGNEFGVVK
YANYSLTILEPALISKGLQDETVATGVTVHFWCDVRGSPAPTVTWLHNAAPVRVSPRHLL
TGNGLQISNVTQEDSGLYQCIADNGVGFGESTGRLRVQPGRSSRPVIVSSPASITVIDGG
DVTLSCNATGLPVPIIRWYDSRGLMTSHPSQVLHSKPQKPPQAVLGSAVAEPTYFSVSQA
GWSSLHVRNVTPERAGEYTCEAINEHGSVVSKAFLTVVPFETGTKAEEMAPVEIAQSDES
EGDFGAETAFSSSPPTKLHLEAAATEKASNIAAPPEAPIILSPPQTLKPDIYNLVWRSGR
DGGLPINAYFVKYRKLDDSVGTVGSWHTVRVPGSENELRLTELEPSSLYEVLMVARSAAG
EGQPAMLTFRTSKERTSSSKNTQAPSPPVGIPKHPIVHEGTNNFGVVLPDLSRHSGVPEA
PDRPTISTASESSVYVTWIPRANGGSPITAFKVEYKRLGRNSDWLVAADNISPSKLSVEV
RNLEPGEMYRFRVIAVNNYGESPRSAASRPYQVAGFTSRFSNRPITGPHIAYTEAISDTQ
IMLKWTYITSSNNNTPIQGFYIYYRPTDSDNDSDYKRDIVEGTKQWHLINHLQPETSYDI
KMQCYNEGGESEYSNVMICETKVKRTPGASEYPVKDLSTPPNPPDRVGGSGAGPSNGPVR
SSDMLYLIVGCVLGVMVLILIVFIAMCLWKNRQQNAMQKYDPPGYLYQGADINGQMIEYT
TLPGTSRVNGSIHGNFISNGGLSNGCPHVHHKVANGVNGIMNGGAGLYPGHTSSLSRTHV
DYEHPHRLVNGGGMYTAVPQADPSECINCRNCRNNNRCFTKTNGTFSSSALPIVPLVAPY
QQDSLEMKPLNHHVMVAMCLASTVPECSTRLEEDSKEKAEQPSAQHPCCREGMNRLSVDY
ADGDNCVLSETSNHILSWSPLILQPVSKDCKEKPGWSSSRVTLNGSGDLPQLQLQET
NT seq 3774 nt   +upstreamnt  +downstreamnt
atgcatccagctcctggactcttacaggcactgctcttcatcactgccgtgggtctcatc
tctgccacgagttcaggtttaactccccgttttatttctgagcccttgtctgctgtccag
aagtctggtgggcctgtacaactccactgttctgctgagccctccatggctcgcctttct
tggctgtttaatggggagcctctggaaagcaaggttggagaagtggaaatccagtcagga
tctttgacaatcgtctccctcagcctgtcaacgtccggtcgctatcagtgtgttgctaac
agcagcgtgggtgctgttgtgagcaggcctgcgatggtatctataggccgtttagctaat
tttgatatgtcggtgaaacctgttgtcgcagcagaggaaggaggcacagctttcattggg
tgcaaggtgccagatagtaaccctaaagcacaggttcgctttcaagtgcagggaaaatgg
ctggaacaatcaacagacaactacctaattcttccatctggaaacctgcagattttgaat
gtatctttagaagacaaaggatcctataaatgtgcagcatacaacccagttactcacgat
ctcagaatagaactcaccggacgtaagctcatagtcacacgctcttcctcaggtagcttc
cacatacttcaccccctggtaccacagagcctggcagtgccccaacacagctctctgatg
ctagaatgtattgtcagtgggttgcctccgtcctctgtccgctgggttaaagacggccgg
gatgtgctaagcaaaggcaggtggaaactgctgcactctcatctggtgacagacaggctt
gaggcatcggactctggaaattactcctgcatggtgggaaatgaatttggagtagtgaaa
tacgctaactattcacttactatacttgaacctgccttgatctccaagggactgcaagat
gaaaccgtggccactggagtgactgtgcatttctggtgcgatgttcgtggaagccctgct
ccgactgtcacctggctccacaacgcagctcccgtccgcgtctccccacgacatctgctg
acagggaacggtctgcagatctccaacgtcacccaagaggactctgggttgtaccagtgt
atagctgacaatggggttggatttggggagtctactggcagacttcgtgtccagccaggt
aggagctctagaccggttatagtctcttcaccagcaagcatcactgtgatagatggtggg
gatgttacactgtcttgcaatgccactggcctacctgttcccatcatccgttggtacgac
agcagaggacttatgaccagccacccttcccaggtgcttcactcaaaaccgcagaaacct
cctcaagcagtgctgggcagcgccgtggcggagcccacctacttctctgtgtctcaagcg
ggctggagctccttgcacgttaggaacgtgactcctgagcgtgccggggagtacacgtgt
gaagccatcaacgagcacggctccgtggtgtctaaagccttccttacagttgttcctttc
gaaactggcacgaaagcagaagaaatggctcccgtggagattgcccagagcgatgaaagt
gagggtgattttggtgcagaaacagcgttttcaagctcgcctccaacaaaattgcatttg
gaagcagctgcaacggaaaaagcctcgaatatagctgctccccccgaggcccccatcatc
ctcagccccccgcagacactgaagccagacatatacaacctggtgtggcgttcggggcgg
gatgggggcttgcccatcaatgcctactttgtcaaataccgcaagctggacgacagtgtc
ggtacagtgggaagctggcacacggtgcgtgtccctggcagtgagaacgagctgcggctc
accgagctggagccttccagcctctatgaagttttaatggtggcgaggagtgccgctggt
gaaggccagcctgccatgctgacatttcgcaccagcaaagaaagaacatcatcttcaaaa
aacactcaggctccatctccaccggtaggcattcctaaacatcccattgttcacgaaggc
acaaataattttggcgttgtccttccagacctgtctcgacacagtggagttccagaagct
cccgaccgacccacgatctccacagcatcggaatcatctgtctatgtcacgtggatacca
cgagcaaacggcggctcccccattacggcctttaaagtcgagtataaacgcctgggtcga
aacagtgactggctagttgcggctgataacatttctccttccaagctctctgtggaagtt
cggaacttggagccaggagaaatgtataggttccgtgtgattgctgtgaacaattacggg
gagagcccacgcagtgcagcatcccgcccttaccaagtagctggatttaccagccggttt
tcgaaccgccctatcacgggacctcacattgcttataccgaagccatcagtgacactcag
atcatgttaaaatggacgtatattacatcaagcaacaacaacacacccatccaaggattt
tatatctattaccggcctacagacagtgacaatgatagtgactacaagagggatatcgtg
gaaggtacaaagcaatggcacttgataaatcacctgcagccagaaacatcttacgacatt
aaaatgcagtgctataacgaaggtggtgaaagcgagtacagcaacgtcatgatctgtgag
accaaagtgaaacgcacgccgggagcttccgaatatccagtgaaagatctgagtacgcca
ccaaatccccccgaccgggttgggggaagcggagctggcccttccaacggccccgttcgg
agcagtgacatgctgtacttgattgtgggctgcgtccttggggtgatggtccttattctc
attgttttcattgccatgtgcctgtggaagaaccgtcagcaaaacgccatgcagaaatat
gaccctcctggctatctgtatcaaggggcagatatcaacgggcaaatgatcgagtacacg
accttacccggcacaagcagagtcaacggcagcatccacggaaacttcataagcaacggc
ggcctcagcaacggctgtccgcatgtccatcataaagttgctaatggagttaacgggatc
atgaatggaggagctggactgtacccagggcacaccagctccctgtccaggacacacgtg
gactatgaacatccccaccgtcttgtgaacggcggtgggatgtacacagcagtgccgcag
gctgatccctcggagtgcatcaattgccgaaattgtcggaacaataacaggtgtttcacc
aaaaccaacggcactttcagcagcagcgcgctacccatcgtgcccctcgtagcaccttat
cagcaggacagtttggagatgaaacctctgaatcaccacgtcatggtggccatgtgcttg
gcctccaccgtcccagagtgcagcacccggctggaggaggacagcaaggagaaagcggag
cagccctcggcccagcatccctgctgtcgagaaggcatgaaccggctctctgtggattac
gcggatggtgacaactgcgtgctctcggaaacatcgaaccacattttgagctggagtccc
cttattctgcaacctgtttcgaaggactgtaaggaaaaaccaggatggagttcatccaga
gtcaccttaaacggttctggggaccttccgcagctccagctgcaggaaacctga

DBGET integrated database retrieval system