KEGG   Falco peregrinus (peregrine falcon): 101914033Help
Entry
101914033         CDS       T02856                                 

Gene name
CEP250
Definition
(RefSeq) centrosomal protein 250
  KO
K16464  centrosomal protein CEP250
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fpg03036]
    101914033 (CEP250)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    101914033 (CEP250)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rootletin
Motif
Other DBs
NCBI-GeneID: 101914033
NCBI-ProteinID: XP_013152844
LinkDB All DBs
Position
Un
AA seq 2599 aa AA seqDB search
MGDRRPRLARRACTAQGSRHVLQYRTLCRELEQQVEAGGGCLPGKWEATEDHSLEKALLQ
VEEEQQRCENLAEVNTLLREHLNKANEVNSALREDVGKLTADWMRAREELELKESEWRND
RELYENYLRGEHNRLIGLWRQVVTFRRHFLEMKTATDRDLSELKAEQMRLSGSVLVNCSR
LNSSIQLWESITLGRPVLKDQAQQQAGQEINQKTGEVMCLQVKEDMEKKELQDRVMELSA
LLVQSQKQNEEKEKAVKMLNDTLEILEASQLEREYEASLTKSAKEENLSLQKVIKDITEV
VLDDSDSTVNIICTESSQHAEYSNILSSLRSVDAEHAFVLVQEALARRQGATQALKEELS
ARQDSINFLLHQHRQWEEKCRKLQQRVEQLEEECKMSSSHQQHLHSLVEALRSDCANLEK
TREDLQQQLEVTEREASRLRQSNTELQLKEDSAQGEMAEQQQMMERARSDQELLMKDLAV
LEEKYSLLQNELVVARETLEELHLQRDLLKQEKHELTMALEKAEQSVAELTGAQNKLSAE
IAELRVATGNMSSINEALALDKVQLNTLVLQLEQENEVLSGKVGEMERAKISDQEKLNLC
KRTNEELCAEKARLEQLLKKAEEQQEGLQVQLTILAEEKEETQEKLSQVYHQQESASSGL
EQLRQESSRQGHALAKVTKEKELLVHEKAALEVRLAAMERDRHGLSEQLAEARSLKETLE
SSLFEAQQRLSQLEITKSQLEIQLHAVTQAKEVIQGEVKCLEHELEAERALMKQERENMK
QQLMQTEQQYNNTLKLQETDHGVEINKLLQDLAREREGRNSELQEMREQWEKEKAEREGE
HEKKLFDMKERVATMQAQQEEELIRVEDAKQQVLLEEEREKKALLETLVQTQRELRDTCQ
QLEQLRQEVKEQQENGQNMTEMLQAELQETHSKIQAAEKRHKEEIKTIGEEMGVLLQQRD
ALQKQVEELTSQLAASEESQQVTGRKAQQEVSEAQELSRQKALEVMHLQKILEEKKSQWE
EVEHQNKELQACLQSLEGERSRWEEVEHHNTEFQASLKVLESEKARLTLSLEEKEKSLRT
LEENSFAQHNEVSRLLSAVHQAQQLHSDHRREIQELNNQIESLQEVVLEKEAGLAAREKQ
LLKDLEESRANEQCLRDSLRMLEAEMSELRLRLCSTENRAKALATEHQQANRAHCDARSQ
LDKLHSALHRMIRDSRDLVTWSSEQGQVWDLTVSQAKDLPAELTVDRVAAALQDLRQHLM
QTQQDLNDARKKIQDSELELSRWQAGRDRFSTHNQKLQKQMAQSQEETQVAECKKNSLQA
ALQEEAAALKEEATTLHQEVVSLEKKLESTERQRKDVLHERDRLQALKEELVWEIKILQE
SVTASETRANTATDMNHSLEQELQTTLSILKIKNEELETQWEKIQMLQKVAAEGDALQEN
LTLMTAILSEREGEMKLYQEQIRTLEKQKEMHKTTLNQAIKDLTEKKQETESQQEHIQEL
EKQQEEQGIALSKMNKDLEEKDQEIRSQQEQIAELEKQRDMQRTAVGKMSKDLEERDQEI
KSQQEQIVELEKQRDMQRTAVGKMSKDLEERDQEIKSQQEQIAELEKQRDMQRTAVGKMS
KDLEERDQEIKSQQEQIVELEKQQDMQRTAVGKMSKDLEERDQEIKSQQEQIVELEKQQD
MQRTAVGKMSKDLEERDQEIKSQQEQIVELEKQQDMQRTAVGKMSKDLEERDQEIKFQEG
KIMVLEQHAASQVRNLLVDLDRMKGNLKEKNIELMSLTQQIQELEKEREEVKSLHASLEH
LRAILKDRESECDSQRGQLRYLQQYKEQQDGHLQELHGKVEKMTLSLSKKDQEFDSQQKQ
IQEVEEVMERQLSIVRDQLEQTLVTLKEKDRLIDIQKQQMRSYEEKTEEQMNVLHRDLEY
TKAILEEKDLVIGSQREVIETFQKQEQDSNQQKEILQHLQVALKEQEQEILSLRNQCESC
KEEEENHEAEQANLQATKLTLKEREEKIEVLEEAISKLQQQKEEAAMQTKAILQKLECAE
SSLETRDQEIASLQEHVQHLQEQKELEGKQAKNLQQDLDKMSQIAKKNHLEFLRQTEQIN
MFQLREESMKVALTSCQKQVNLLEEVVRKRDEDNEALTQKLHHQEEELKVLQNLQLRLTE
TNEEVRHHREQEKLLEEALPERDREAKAQGEQKELEEEIRALREDLQHVQQTLTKKGEET
RYQRDRVRYLEETLTGREQELRRQSEVLKQLTSALQWKGEGETLKKQIQKLQKWEEEEAA
KRKVLQERDHLLKRQKELAQQLEDERKAKGEELEHVIAVLKQNESREIEWKGKAQALSLA
LTKSEMANGTLREEIAILQSMVSERDKDRFHLQAIAEGEQLSWLSEKRLLSQRLECLQQT
VARLEQEKTELKQLNDELRRTLEQVERERRRLKRDYGGRSLPGACGFSESDQHKMPASRQ
EESHARCSCRLAELQNQVSLLQTQLAQERKYKQDYIECCAKTSQELSDLHQELSYSLAAV
VREPNATVLEAETWKLDRSLNLNLAVISLDRQSPERQMLHSTARSARSNDLRFPSRSSGG
TKLVLACLDGVSHRPGKAG
NT seq 7800 nt NT seq  +upstreamnt  +downstreamnt
atgggagaccgccgcccccggctggcccggcgcgcctgcacggcccagggctcacggcac
gtgctgcagtaccggactttgtgtcgagagttggaacagcaagtggaagcaggaggggga
tgccttccaggcaagtgggaagccacagaagaccacagcctggagaaagcactgcttcag
gtggaagaggagcagcaaaggtgtgagaatctggcagaagtgaacactctcctgcgggag
cacctcaacaaagcaaatgaggtgaattcagccctcagagaagatgttggaaaactgacg
gcagattggatgagggcccgggaggagctggaattgaaggagagtgaatggcgcaatgac
cgtgagctttatgaaaactacttaaggggtgaacataaccgtctcattggcctgtggcgt
caggtggtaaccttccgccgtcattttctggaaatgaagactgccactgacagagatttg
tcggagctgaaggcagagcagatgaggctttctggatctgtccttgtaaactgctcccgt
ctaaactccagcatacagctctgggagtccatcactctgggtagacctgtcctgaaggat
caggcacagcagcaagcaggacaggaaattaaccagaagactggagaagtgatgtgctta
caggtcaaggaggacatggagaagaaggagcttcaagacagggtgatggagctctcagcc
ctgcttgtacagtctcagaagcaaaacgaggagaaggagaaggccgtgaaaatgcttaac
gacactttggagattctagaagcaagtcagttagagagagaatatgaagcttcattgact
aaaagtgccaaagaggagaatctttccctccaaaaggtgataaaagatataactgaggtg
gtgttagatgacagtgacagtacagtcaacattatctgcaccgagagttcccaacatgca
gagtatagcaacatcctctcttctctgaggtccgttgatgcagagcatgcctttgtattg
gttcaggaagcactggcaaggaggcaaggggcaacacaggccctaaaagaagagctttct
gccagacaggattctatcaatttcttgctgcaccagcacagacagtgggaagagaagtgc
aggaagctgcagcaaagggttgagcagctggaggaggaatgcaagatgtccagcagccac
cagcagcacctccactctctagtagaagcactcagaagtgactgtgcaaacctcgagaag
accagggaagacctacagcaacagcttgaagtgacagagcgagaagcctcgcgtctgcga
caaagtaacaccgaactgcagttgaaggaagattcagcccagggggaaatggcagagcag
caacagatgatggagagagcacgtagtgaccaggagctcctaatgaaggacttggctgtc
cttgaagagaaatattccttattacagaatgagttggtagttgcgagagagacactggag
gaattgcaccttcagagggatctgctgaagcaagagaaacatgagcttaccatggcactg
gagaaggcagagcagtcagtcgcagagttgacaggggctcagaataagctgagtgctgaa
atagctgagctacgtgtcgcaacagggaacatgagcagtatcaatgaagctcttgcattg
gataaagtgcaactgaacacacttgtgctgcagctggagcaagagaacgaagttctgtca
ggtaaagtgggcgagatggagagagcaaagatctctgaccaggagaagctgaacttgtgt
aagagaacaaatgaagagctctgcgcagagaaagcccgcctggagcagctgctgaagaaa
gcagaggagcaacaggaggggctgcaggtacagctgacaatactggcagaggagaaggaa
gaaacccaagagaaactcagtcaggtttaccaccagcaagagtcagctagcagtggtctg
gagcagttgcgccaggagtcctctcgccaagggcacgcactggccaaggtgaccaaagag
aaggaattgctggtgcatgagaaggctgccctagaggtgcgactggcagccatggagcgg
gacagacatggcctttcagagcagctggcagaggccaggtcactaaaggagaccctggaa
tctagcctgtttgaggctcagcagcgcttatctcagctggagatcaccaagagtcagctt
gaaatccaacttcatgcagttacacaggccaaggaggtaatacaaggggaagtgaagtgc
cttgaacatgagctggaagctgagagagctctcatgaagcaggaacgggaaaacatgaag
caacagctcatgcaaacagaacagcagtataacaataccctgaaacttcaggaaactgat
catggagtggaaataaacaagcttctgcaagacctggcaagggagcgggaagggcgcaat
tcagagctgcaggagatgcgggagcaatgggaaaaagagaaggcagagagagaaggggag
cacgagaagaagctgtttgatatgaaggagagagttgctaccatgcaagctcaacaagaa
gaggaactaatcagagttgaagatgccaagcaacaggtcctgctagaagaggagcgtgag
aagaaagctttattagagacactagtccaaacgcagagagagctaagagacacctgccag
cagctagagcagctcaggcaggaggtgaaagagcagcaagagaatgggcagaacatgaca
gaaatgctgcaagcagagctgcaggaaactcacagtaagatccaggcagcggagaagagg
cacaaggaagaaatcaaaaccatcggagaggaaatgggtgtcctacttcagcagagggat
gctctacaaaaacaggtggaagagttgacatctcagctagcagcctctgaagagtcccag
caagtgactggccgcaaagctcagcaagaggtgagcgaggcacaggaactgtcaaggcag
aaggcactggaggttatgcacctccagaagatcttagaggagaagaagagtcaatgggaa
gaggtagaacatcagaacaaggagctgcaagcgtgtctgcagtccttggagggggaaagg
agtcgatgggaagaagtggagcatcacaacacagaatttcaggcttcattgaaggtccta
gagagtgaaaaagccaggctgactttgtctctggaagagaaggaaaagagcctcagaacc
ctggaagaaaacagctttgcccagcacaatgaggtgtctcggcttctctcagctgttcac
caggcccagcagctccattcggaccacagaagagaaatacaagagctcaacaaccagata
gagtcactgcaagaagtagtgctggagaaggaggctggcttggcagctcgagagaagcag
ctgctgaaggatctggaggagtcccgagcaaatgaacagtgcttgagggactctctgcgc
atgctggaggctgagatgtctgaactgcgtttgaggctttgtagcacagagaacagagcg
aaggcgttggccacagagcatcagcaggctaacagggcccactgtgatgcccgatcccag
ctggacaaactgcactcggctctccaccgcatgatcagggacagcagagacttagtcact
tggagttcagaacagggtcaagtctgggacctgactgtttctcaggccaaggacctccct
gcagagctcacagtggacagagtggcagcagccctacaagacctgcgtcagcacctgatg
cagactcaacaagatctgaatgatgcgaggaagaagatacaagactcagagctggagctg
agcaggtggcaagctgggagggaccgtttcagcacccacaatcaaaagctgcagaaacag
atggctcaaagtcaggaagagacacaagtggcagaatgcaagaagaactctctacaagct
gccctgcaggaagaggccgctgctttaaaagaggaggctacaactctacatcaagaggtg
gtgtctttggaaaagaaactcgagagcactgagaggcagagaaaggatgtcctgcatgaa
cgggacagactgcaagcacttaaagaagaactggtgtgggagataaaaattctgcaggaa
tcagtcacagcctctgaaacacgagcaaatacagcaacagatatgaatcactcccttgaa
caagaactccaaactacgttgtctatcttaaaaattaaaaatgaggaattggaaacacag
tgggagaaaatccagatgctacagaaagtggcagcagagggagacgctttgcaggagaat
ctgactctcatgactgctatcctgtcagagagggagggagaaatgaagttgtaccaggaa
cagataagaacgctggaaaagcagaaagaaatgcataaaactactctcaatcaggctatt
aaggacctaacagagaagaaacaggagacagaatcccagcaagaacacatacaggaactg
gagaagcagcaagaagaacaagggattgctctaagcaaaatgaataaagacctggaagag
aaagaccaggagatcagatcccagcaggaacagatagcggagctggagaagcagcgggac
atgcagaggactgctgttggcaagatgagcaaagacctggaggagagggaccaggagatc
aaatcccagcaggaacagatagtggagctggagaagcagcgggacatgcagaggactgct
gttggcaagatgagcaaagacctggaggagagagaccaggagatcaaatcccagcaggaa
cagatagcggagctggagaagcagcgagacatgcagaggactgctgttggcaagatgagc
aaagacctggaggagagggaccaggagatcaaatcccagcaggaacagatagtggagctg
gagaagcagcaggacatgcagaggactgctgttggcaagatgagcaaagacctggaggag
agggaccaggagatcaaatcccagcaggaacagatagtggagctggagaagcagcaggac
atgcagaggactgctgttggcaagatgagcaaagacctggaggagagggaccaggagatc
aaatcccagcaggaacagatagtggagctggagaagcagcaggacatgcagaggactgct
gttggcaagatgagcaaagacctggaggagagggaccaggagatcaaattccaggagggg
aaaataatggttctagaacaacatgctgcatcacaagtgagaaatctacttgtggatctt
gatcgtatgaaaggaaacttgaaggagaaaaacatagagcttatgtcactgactcagcag
atccaagaactagaaaaggagagagaagaggtgaaatctctgcatgcaagtcttgaacac
ctgagagcaattctcaaggacagagagagtgagtgtgattctcaaaggggtcagttaaga
tacttgcagcagtacaaggaacagcaagatgggcacctgcaagagcttcatggtaaagta
gaaaagatgacactttctttatctaaaaaagatcaagagtttgattcacaacaaaagcaa
attcaggaagttgaagaagtcatggaaaggcagttaagtattgtccgtgaccaactggag
cagaccttagtaaccttaaaagaaaaggacagactcatagacatccaaaagcaacaaatg
aggagctatgaggaaaaaacagaagaacagatgaatgtcttacatagagacttagaatac
actaaggcaatactggaagaaaaggatctcgtgattggatctcagagggaagtgattgag
accttccaaaaacaagaacaggactccaatcagcagaaggaaattttgcagcatcttcaa
gtggcactaaaggaacaagagcaagaaattttatcccttagaaatcaatgtgagtcatgc
aaggaagaggaggaaaaccatgaagctgagcaagcaaatcttcaagcaacaaaactgact
ctgaaagaaagagaagaaaagatagaggttctggaggaggctatctctaagcttcaacag
caaaaggaggaggcagcgatgcagactaaagccatactgcaaaaactagaatgtgctgaa
tcttctctagaaactagagatcaagagatagcgtctttgcaagagcatgtgcagcacctt
caagagcagaaggaattagaaggcaagcaagccaagaatttacagcaggatctagacaaa
atgagccaaatagcgaagaagaaccatttagagttcctcaggcagacagagcaaattaac
atgttccagcttcgtgaagaaagcatgaaggtagcactaacatcatgccagaagcaagtg
aatctgcttgaggaagtggtgaggaagagagatgaagacaatgaagctcttacacaaaaa
cttcatcaccaagaagaagaactgaaggtcttgcagaatctccagcttaggctaactgaa
acaaatgaagaggtcaggcaccacagagagcaagagaagcttctggaggaagccttgcct
gagagggaccgagaggccaaggctcaaggtgagcaaaaagagttagaagaggaaataaga
gctcttcgggaagatctccagcacgttcagcagaccctgacaaagaagggtgaagagacc
aggtatcagagagacagagtcaggtatttagaggagactctgacagggagagagcaagag
cttaggaggcagagtgaagtcctgaaacagttgacatcagctttacaatggaaaggtgaa
ggggagaccctaaagaaacaaatccagaagctccaaaagtgggaagaagaggaagcagca
aagaggaaagttctccaggagagagaccatctcttgaaaaggcagaaggagctagcccaa
caactggaagatgagaggaaagcaaagggggaagaactggaacatgtgattgctgttttg
aagcagaatgaaagcagagaaattgaatggaaagggaaggcacaagcactcagtcttgct
cttaccaagagtgaaatggccaatgggactctgagggaagaaatagccatcctgcaaagt
atggtttcagagagggacaaggaccgctttcatcttcaggctattgcagaaggggagcag
ctatcatggctctcagagaagagactcctgtcacagcggctggaatgtctgcagcaaaca
gttgcaaggctggaacaggagaagactgagctgaagcaactcaatgatgagctcagaagg
actcttgagcaggtggaacgtgaacggaggagactgaaaagagattatggtggtcggtca
ctgccaggtgcatgtggattttctgagtctgaccagcacaagatgcctgcttctagacag
gaggagtctcacgctcgctgcagttgtcgattagctgagttacagaaccaggtgtccctt
ctgcagacccagctggcacaagaacgaaaatacaagcaggactatattgagtgctgtgca
aagaccagccaggagctgtcagaccttcaccaagagctctcttactccttagcagctgtg
gtcagggagcccaacgctactgttctggaagcagagacctggaagctggatcggtctctg
aaccttaacttggctgtgatctctctggaccgtcagtctcctgagagacagatgttgcat
tcaacagccagatcggccagaagcaatgacctgaggttccccagcagaagcagtggtggg
acaaaactggtgctggcttgtctggatggggtcagtcataggcctggaaaagcaggatga

DBGET integrated database retrieval system