KEGG   Falco peregrinus (peregrine falcon): 101914153
Entry
101914153         CDS       T02856                                 

Gene name
FBXW11
Definition
(RefSeq) F-box and WD repeat domain containing 11
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04114  Oocyte meiosis
fpg04120  Ubiquitin mediated proteolysis
fpg04218  Cellular senescence
fpg04310  Wnt signaling pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101914153 (FBXW11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101914153 (FBXW11)
   04340 Hedgehog signaling pathway
    101914153 (FBXW11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101914153 (FBXW11)
   04218 Cellular senescence
    101914153 (FBXW11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fpg04121]
    101914153 (FBXW11)
   03036 Chromosome and associated proteins [BR:fpg03036]
    101914153 (FBXW11)
Ubiquitin system [BR:fpg04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     101914153 (FBXW11)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     101914153 (FBXW11)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like F-box WD40_like Nup160 DUF1513 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 101914153
NCBI-ProteinID: XP_005232417
LinkDB
Position
Un
AA seq 531 aa
MCALRCLQSMPSVRCLQNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYEK
EKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHI
AENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYL
FKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDE
KIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGE
VLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDF
DDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIE
CGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEH
SGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtgcgcactgagatgcctgcagagcatgcccagtgtcagatgtctccagaacacgtca
gtaatggaggatcagaatgaagatgagtctccaaagaaaaataccctatggcagataagt
aatggaacttcatctgtgattgtctcaagaaaaagaccatcggaaggaaactacgaaaag
gaaaaagacttgtgtattaaatattttgaccagtggtctgaatcagatcaagttgaattt
gtggaacatcttatttcacgaatgtgtcactatcagcatggacatattaactcttacttg
aagcccatgttacaacgggacttcatcactgcgttaccagagcaaggcttagatcacata
gcagaaaacatcctttcctatcttgatgccagatcactctgtgcagcagagctggtatgt
aaggaatggcagagagtcatctctgagggaatgctatggaaaaaattgattgaaagaatg
gtacgcacagacccgctatggaagggactgtcagaaagaaggggttgggatcagtacctg
tttaaaaacagaccaacagatggccccccaaattcattttacaggtccttatacccaaag
ataatacaggatatagagactatagaatctaactggcgatgtgggcggcataatttgcaa
aggattcagtgccgctctgaaaacagcaaaggtgtctactgtttacagtatgatgatgaa
aagattatcagtggcctacgagacaactccattaagatttgggacaaaacaagcttggaa
tgtttgaaagtattaacaggacatactggctcggttctttgtctgcagtatgatgaaaga
gtcattgtaactggatcttcagattctacagtgagagtttgggatgtaaatacaggtgaa
gttctgaacacgttgattcatcacaacgaggcagtgcttcatttaaggttcagcaacggc
ttaatggtgacatgctcgaaggacagatcaattgctgtttgggatatggcatcacctact
gacatcaccctgcgccgtgtcttagttggccatcgtgctgctgttaacgtggtagacttc
gatgacaagtatattgtgtcagcgtcaggtgacaggaccattaaagtctggagtacaagt
acatgtgaatttgttcgtactctgaacgggcacaagcgtggcattgcgtgcctccagtac
agggatcgactagttgtcagtggatcttcagacaataccatccgactatgggacattgaa
tgcggtgcctgtttaagagtattagaaggccatgaagaacttgttcgatgcatcaggttc
gacaataagaggattgttagtggagcctacgatggcaaaattaaagtttgggacttgcaa
gctgctcttgaccctcgtgccccagcaagtacattatgcttgcgtacgttagtggaacat
tcaggacgtgtctttagacttcagtttgacgaatttcagatcattagtagttcccatgac
gatacaattctgatttgggatttcttaaacgtgccacccagtgcccagaacgagacccgc
tctccatctagaacatacacttacatctccagataa

KEGG   Falco peregrinus (peregrine falcon): 101920782
Entry
101920782         CDS       T02856                                 

Gene name
BTRC
Definition
(RefSeq) beta-transducin repeat containing E3 ubiquitin protein ligase
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04114  Oocyte meiosis
fpg04120  Ubiquitin mediated proteolysis
fpg04218  Cellular senescence
fpg04310  Wnt signaling pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101920782 (BTRC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101920782 (BTRC)
   04340 Hedgehog signaling pathway
    101920782 (BTRC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101920782 (BTRC)
   04218 Cellular senescence
    101920782 (BTRC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fpg04121]
    101920782 (BTRC)
   03036 Chromosome and associated proteins [BR:fpg03036]
    101920782 (BTRC)
Ubiquitin system [BR:fpg04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     101920782 (BTRC)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     101920782 (BTRC)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 F-box WD40_like Nup160 F-box_5 DUF4508
Other DBs
NCBI-GeneID: 101920782
NCBI-ProteinID: XP_013155897
LinkDB
Position
Un
AA seq 587 aa
MPRSLWLGCSSLADSMPSLRCLYNPGTGALPAFQNSSEREDCNNDEPPRKIIPEKNSLRQ
TYNSCARLCLNQETVCLGSTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCV
KYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILS
YLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLSERRGWGQYLFKNKPP
DGTAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVS
GLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNT
LIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKY
IVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGAC
LRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRV
FRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAESTRSPSRTYTYISR
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgcccagatctctgtggctgggctgctccagcctggcggacagcatgccctcactgcga
tgcctgtataacccagggactggcgcactcccagctttccagaattcctctgagagagaa
gactgtaataatgatgagccccctaggaagatcattccagagaagaattcacttagacag
acctacaacagctgtgccagactgtgcttaaaccaggaaacagtatgtctaggaagcact
gctatgaagactgaaaattgtgtggccaaaacaaaacttgccaatggcacttccagtatg
attgtgcccaagcaaaggaaactgtctgcaagctatgagaaggagaaggaactctgcgtc
aagtattttgaacagtggtctgagtctgaccaggtggagtttgtggagcacctcatctcc
cagatgtgtcactaccagcacggacatataaactcatacctcaaacctatgttacagcgg
gacttcatcactgcactgccagctcggggattggatcacattgctgagaacattctgtca
tacctggatgccaaatcgttgtgtgctgctgagctggtgtgcaaggagtggtaccgggtg
acgtcggatggtatgctgtggaagaagctcatcgagagaatggtcaggacagactccctg
tggagggggttgtcagagaggagaggatggggacaatatctatttaaaaataaacctcct
gatgggactgcaccacccaactccttctacagagcactttaccccaaaattatacaggac
atagagacaatagagtcaaactggcggtgtgggaggcacagtttacagaggatccactgc
cgaagcgagacaagcaaaggggtttactgtttacagtatgatgatcagaagatcgtaagt
ggcctacgggacaatactatcaagatctgggataagaatacattggaatgcaagcgaatt
ctcaccggacacacgggttctgtcctgtgcctccagtacgatgaacgggtgatcattaca
ggatcttcagattcaacagtcagggtgtgggacgtaaatgcaggcgagatgctgaataca
ctgattcatcactgtgaagcagtattgcacctccgcttcaataacggcatgatggtgacg
tgttccaaagaccgttccattgctgtgtgggacatggcttcaccaacagacatcaccctg
aggagggtgctagtagggcaccgagctgctgtcaacgtagtggactttgatgacaagtac
attgtatcagcatcaggtgacagaactataaaggtatggaacactagtacctgtgaattt
gtgcgcaccttaaatggccacaaacgaggcattgcatgtctgcagtacagagacaggcta
gtagtgagcggctcttcagataatactatcagactgtgggatatcgagtgtggggcatgt
ttacgggtactggaaggccatgaagagttggtgagatgcatacgctttgataacaagagg
atagtcagtggggcatatgatgggaaaattaaagtatgggatcttgtggctgctttggac
ccccgtgctccagcagggaccctctgcttgcgaacccttgtggaacattctggaagggtc
tttcgactccagtttgatgagttccagattgtcagcagctcacacgatgacaccatcctc
atctgggattttctgaatgacccagctgcccaagcagaatccactcgttccccgtccaga
acatacacctacatctcaagataa

DBGET integrated database retrieval system