KEGG   Falco peregrinus (peregrine falcon): 101914244Help
Entry
101914244         CDS       T02856                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00052  Galactose metabolism
fpg00500  Starch and sucrose metabolism
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101914244 (GANC)
   00500 Starch and sucrose metabolism
    101914244 (GANC)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101914244 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N POC3_POC4
Motif
Other DBs
NCBI-GeneID: 101914244
NCBI-ProteinID: XP_013159761
LinkDB All DBs
Position
Un
AA seq 864 aa AA seqDB search
MLSDENVKFHIIHEENKVLLQVEICEIEGNIFRLKIDEATPLRARYKVPDVLTKEPTTQR
LFISQKEAGILVLSSVSEDYKLQVTANPFQVELQSKGETVLSMNSNGLLYFEHLQPLPCD
RKPTGENEEAASDSCKGKQEDLGLWQEKFGSFLDVKAHGPSSVGTDFSLHGFDHVYGIPQ
HTEALLLRNTSDGDAYRLYNLDIFGHKIHDKIGIYGSVPILLAHKPNRTAGIFWLNSSET
LVDISTKAVAEPMSSGSAAEAAKQRAVPLTDVRWMSESGIIDVFLLMGPTAFDIFKQFAQ
LTGTQALPPLFSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVIWLDIEHTDGKRYFTW
DKKKFQNPRKMQEHLRKKKRKLVVIVDPHIKIDPTYTLYSQAKDKGYFVKDRNGQDFEGI
CWPGSSCYLDFTNPEVRKWYADQFTFKTYKGSTNILFVWNDMNEPSVFKGAELTMQKDAV
HYNNWEHREVHNLYGFYQQMATAEGLIRRSSGKERPFVLTRSFFAGSQKYGAVWTGDNTA
EWSYLKISIPMLLTISMAGISFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHSNMES
KRREPWLFGEKNTQIIREAIRERYVLLPYLYTLFYRAHTAAEPVMRPLWVEFPGKTETFG
VENEYMLGNALLVHPVTEQEAKAVSVLLPGSEEIWYDFRKFKRMEDSGTLKIPVTLENIP
VFQRGGTVIPLKTRAAKSTEWMIDISYELHVALDTEACAIGELYLDDGHSFQYLHKKQFL
YQKFTFQKNILSSSRTEESGKYHTTCVVERVIVLGFGQQPTFVTACSKDGKGKEVVFTYN
MKTSALTLENLALSVDADWQIYIN
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtgatgagaatgtcaaattccatattattcatgaggagaataaggttcttcta
caagtagaaatttgtgaaatagaaggcaatattttcaggcttaaaattgatgaggcaact
cctctcagagcaagatacaaagttcctgatgttcttacaaaggaacctaccacccagaga
ctcttcatatcccagaaggaggcaggtattttggtgctgtcaagtgttagcgaggactac
aaacttcaagtcacagcaaatcccttccaggttgagctacagtccaagggtgagactgtt
ctgagcatgaattccaatgggttgttgtattttgagcacctacaaccacttccctgtgat
agaaaacctacaggagaaaatgaggaggcagcaagtgattcctgcaaggggaaacaggag
gatctaggtctctggcaagagaaatttggcagtttcttagatgtcaaagctcatggtcct
agttcggtaggcacggacttctctctacacggatttgaccatgtttatggaataccacaa
cacacagaagcacttcttctcagaaacaccagtgatggtgatgcctaccggctttataat
ctggatatcttcggccacaagatacatgacaaaataggcatttacggttcggtgcccatt
ctcttagcacataagcctaacagaactgcagggattttctggctgaactcttcagaaacg
ctggtggatattagtacaaaggcagtagctgagcccatgtcatccggatctgcagcagag
gctgctaagcagagagcggtgcctctgactgatgtgcgctggatgtcagaaagtgggatc
attgatgttttcctgctgatgggacccactgcatttgatatcttcaagcagtttgcacaa
ctgacaggcactcaagccctgcccccccttttttctctgggctaccatcagtgccggtgg
aattatgaggatgagcaagacgtcaaggcagtagacgctggctttgatgaacatgacatt
ccttatgatgtgatatggctggacatagagcacacagatggcaaaaggtattttacttgg
gacaaaaagaaattccagaaccccagaaagatgcaagaacatctcaggaagaaaaaacgc
aagcttgtcgtcattgtagatccccacattaagattgatcccacgtataccctgtattca
caggcaaaagacaaaggatattttgtgaaagacagaaatgggcaagattttgagggcatc
tgttggccaggttcctcttgttacctggatttcaccaatcctgaagtgcgaaaatggtat
gcagatcagtttaccttcaaaacatacaagggatccactaatatcctgtttgtgtggaac
gacatgaatgagccttcagtcttcaaaggggcagaactaacaatgcagaaagatgctgtg
cactacaacaactgggagcatcgggaagtacacaacctctacggattctaccagcaaatg
gcaactgcagaaggactcataagacgttcttcaggaaaagagagaccatttgtcctcaca
cggtctttctttgcaggatcacagaagtatggggcagtgtggactggagacaacacagca
gagtggagttacttgaaaatatccattccaatgcttctcaccatcagcatggcagggatt
tctttctgtggagctgatgtgggagggtttattggagatccagaaccagaattacttgtt
cgctggtatcaggctggagcctaccagcccttcttcagaggtcattctaacatggagagc
aaacggcgagaaccgtggctctttggggagaagaacacccagatcatcagggaagccatt
agagagcgctacgtcctcctgccatacttatacacactgttctatcgggctcacacagcg
gctgaaccagtgatgaggcctctctgggtagagtttccagggaaaacagaaacttttggt
gtggaaaatgagtacatgctgggaaatgctttgttggtgcatccagtcacagagcaagaa
gccaaggccgtgagtgttctgcttccagggtcagaggagatttggtatgatttcaggaaa
tttaaacgaatggaagattcaggcactctgaagatcccggtaacactggagaatattcct
gtattccagcgggggggcactgtgatacctctgaagaccagggctgcaaaatccactgaa
tggatgatagatatttcttatgaactccatgtggccctggacacagaggcctgtgcaata
ggtgagctctacctagatgatggacattcatttcaatatctccacaagaagcagttcctg
tatcagaaattcactttccagaagaacattctctcttccagccgcacagaagaaagcggg
aagtaccacactacatgtgtggttgaacgggtgatagttctgggatttggacagcagccc
acttttgtgacagcctgttccaaggatggtaaaggaaaagaagtggttttcacatacaat
atgaagacctctgcactgacgttggaaaatttagccctgagtgttgatgctgactggcag
atctacatcaactga

DBGET integrated database retrieval system