KEGG   Falco peregrinus (peregrine falcon): 101914298
Entry
101914298         CDS       T02856                                 

Definition
(RefSeq) casein kinase I isoform delta-A-like
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
fpg04540  Gap junction
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101914298
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101914298
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101914298
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fpg03036]
    101914298
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101914298
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   101914298
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101914298
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 101914298
NCBI-ProteinID: XP_013158637
LinkDB
Position
Un
AA seq 219 aa
MFGDVGVPTIKWCGAEGDYNVMVMEPFGPSIEDLFSFCSRKFSLETVLLLADQMTSXIEY
IHSKNFIHRVVKPDNFIMGLGKKGNLVYIIDSGLAKKYRDARTHQHIPYRENKNLTGTAC
YESINTHLGIEQSCRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKXERVSEKKMSTPVE
VLCKGYSLLQKLIRMMKWSPLSRIRELYLWRNRISLVWR
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtttggcgatgtgggcgttcccacaattaagtggtgtggagctgaaggggattacaat
gtaatggtgatggagccgtttggaccaagtattgaagatctcttcagtttttgttcaagg
aaatttagtctcgagacagtcctattactcgctgaccaaatgactagttgaattgaatac
attcactctaagaacttcatccaccgagttgtgaagccagacaacttcataatgggcctt
gggaagaaaggcaatcttgtctacataatagactctggattagcaaagaagtatcgagac
gctcgaactcaccaacatattccatatcgtgaaaataaaaacttaacaggaactgcctgt
tatgaatccatcaacacacatcttggaatcgagcaatcttgcagagatgacttggagtcc
ttgggatatgtactgatgtattttaacctgggctccctcccctggcagggactgaaagca
gcaacaaagaggcagaaataggaacgtgtcagtgaaaagaaaatgtctacacccgttgag
gttttgtgtaaaggatattccttactccaaaaactgatcaggatgatgaagtggagccca
ttgtctcgtatacgggaactgtatctgtggagaaacaggatttctcttgtttggagatag

KEGG   Falco peregrinus (peregrine falcon): 101914830
Entry
101914830         CDS       T02856                                 

Gene name
CSNK1G3
Definition
(RefSeq) casein kinase 1 gamma 3
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101914830 (CSNK1G3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101914830 (CSNK1G3)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101914830 (CSNK1G3)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   101914830 (CSNK1G3)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 101914830
NCBI-ProteinID: XP_005242578
LinkDB
Position
Un
AA seq 456 aa
MDNKKKDKDKPDERMARPGGRSGHNPCGTGSSNSGVLMVGPNFRVGKKIGCGNFGELHLG
KNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGADGIPQVYYFGPCGKYNAMVIELL
GPSLEDLFDLCGRMFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNQTQQ
IIHIIDFGLAKEYIDPETKQHIVYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMF
MYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLHYVRRLDFFEE
PDYDYLRKLFTDLLDRKGYMFDYEYDWIGKQLPTPVGSIHSDPALSSNRESYQHRHKMQQ
SKNQSTDHRAAWDSQQANPHHLRAHLGANRHGGSVQVVSSTNGELNTDDPTAGRSNAPIT
APAVEVMDETNCQKVLNMWCCCFLKQKKRKNIHRHK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggacaataagaagaaagacaaggacaagccagatgaaagaatggcacggcctggtggg
aggtcaggccataatccatgtggaactggttcatcaaattctggagtgttaatggttggc
cctaacttcagagttggcaaaaaaattggatgtggtaattttggagagctacatttagga
aaaaatttatacacaaatgaatatgtggcaattaagctggagccaatgaagtcgagagca
ccacagctacatttggaatacagattctacaagcagctaggatctggagcggatggaatt
cctcaggtttactattttggcccatgtggcaaatacaatgctatggtgatagaactgctt
ggacctagtctggaagatttatttgacttgtgtggtaggatgttttctcttaaaaccgtt
cttatgatagccatacagttgatttctcgtatggaatatgtccattcaaagaacttgata
tacagagatgtaaaacctgagaacttcttaataggacgacctggaaaccaaacccagcaa
attattcatattatagattttggtttggcaaaggagtatatagatccagaaactaagcag
cacatagtttatcgagaacacaagagccttacaggaacagctagatacatgagtataaat
acacatttaggaaaagagcaaagtagaagagatgatttggaagctttaggtcatatgttt
atgtattttctcagaggaagccttccatggcaaggtttaaaggctgacacattaaaagaa
cgttaccagaaaattggagacacaaaacgagcaacccctatagaagtattatgtgaaaac
ttcccagaggaaatggctacatacctacattatgtaaggaggctagatttttttgaggag
ccagactatgactacttaaggaagctcttcacagacttacttgatcggaaaggctatatg
tttgattatgaatatgactggattggcaaacagttgcctactccagtgggttcaatacat
tcagaccctgcactatcttcaaacagagaatcatatcagcacagacataaaatgcagcaa
tccaaaaatcagtcaacagaccatagggcagcctgggactcgcagcaagccaatccacat
catttgagggctcacctaggagctaatagacatggtggctcggtacaggtagtaagctca
acaaatggagaactgaacacagatgacccaactgcaggccgttcaaatgcacccatcaca
gctcctgcagtagaagtaatggatgaaaccaactgccagaaagtgttgaacatgtggtgc
tgctgctttttaaagcagaagaaaagaaaaaacattcatcgccacaaatga

KEGG   Falco peregrinus (peregrine falcon): 101917869
Entry
101917869         CDS       T02856                                 

Gene name
CSNK1G2
Definition
(RefSeq) casein kinase 1 gamma 2
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101917869 (CSNK1G2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101917869 (CSNK1G2)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101917869 (CSNK1G2)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   101917869 (CSNK1G2)
SSDB
Motif
Pfam: Pkinase CK1gamma_C PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 101917869
NCBI-ProteinID: XP_005240840
LinkDB
Position
Un
AA seq 415 aa
MDFDKRGGKGELEEGKRMSKTGGGRSSHGSRSAGTNSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNAEGIPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKR
QHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPVEVLCENFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFERNGYVFDYEYDWAGKPLPTPIGTMHSEVQVQPPNRDKAQPHTK
HQVMSSTNGELNTDDPTAGHSNAPITAPTEVEVTDDTKCCCFFKRRKRKTTKRRK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggattttgataagagaggagggaaaggggagctggaggaaggtaaaagaatgtccaag
acaggcggaggaaggagcagtcatggaagccggagtgctggaaccaactcgggagtctta
atggtgggtcccaacttccgggtcggcaagaagattggatgcggcaatttcggggagctc
cgtctaggaaagaacctctacacaaacgaatacgtagctatcaaattggaacccataaaa
tcccgggccccccagctgcacctggagtatcggttctacaaacagctcggcaatgcagaa
ggaattcctcaggtttactactttggcccctgcgggaagtacaatgccatggtgttggag
ctgctaggacccagcctagaagatctctttgatctgtgtgatcggaccttcacgctcaag
accgtcctgatgatcgcaatccagctgatcacacggatggagtatgtccacaccaaaagc
ctgatctacagagatgtcaagccagagaacttcctggtggggcggccgggcagcaagcgg
cagcacaccatccacatcatcgattttggcctggccaaagagtatattgaccccgagacc
aaaaaacacatcccctaccgagagcacaagagcctgacagggacagcacgctacatgagc
atcaacacccaccttgggaaagaacaaagccgcagggatgacctggaagcattagggcac
atgtttatgtacttcctccgtgggagccttccttggcaaggcctcaaggctgacacgcta
aaggagaggtatcagaagatcggcgacactaaaagagccactccagtggaggtgctctgt
gagaacttcccagaggagatggccacgtacttgcgttacgtgcggcggctggatttcttt
gagaagcctgactatgactacctgcggaagctcttcacagacttgtttgagaggaacggt
tacgtgtttgactatgaatacgactgggcagggaaaccgctgcccacccccattggcacg
atgcacagcgaggtgcaggtgcagcccccgaacagagacaaagcacagccacacaccaaa
caccaggtgatgagctccaccaacggagagctgaacacggacgacccgacggcaggacat
tcgaacgcccccatcacagcccccaccgaggtggaggtgacagacgatacaaagtgctgc
tgtttcttcaagagaaggaagaggaaaaccaccaagcgtcgcaagtga

KEGG   Falco peregrinus (peregrine falcon): 101919127
Entry
101919127         CDS       T02856                                 

Gene name
CSNK1E
Definition
(RefSeq) casein kinase I isoform epsilon
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04068  FoxO signaling pathway
fpg04310  Wnt signaling pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101919127 (CSNK1E)
   04340 Hedgehog signaling pathway
    101919127 (CSNK1E)
   04068 FoxO signaling pathway
    101919127 (CSNK1E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101919127 (CSNK1E)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fpg03036]
    101919127 (CSNK1E)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101919127 (CSNK1E)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   101919127 (CSNK1E)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101919127 (CSNK1E)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 101919127
NCBI-ProteinID: XP_005232950
LinkDB
Position
Un
AA seq 416 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDMDRERREHEREERMGQLRGSATRALPPGPPAGATANRLRNVTEPMASTPTSRIQQSG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRISASQTSVPFDHLGK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagcttcgagtggggaacaaataccgtctgggcagaaagattggcagcggttcattt
ggagacatttacctaggagccaatattgcgactggtgaagaggtggccatcaaactggaa
tgtgtcaaaaccaagcacccccagctccacattgaaagcaagttctacaagatgatgcag
ggaggagtgggtatcccctccattaagtggtgtggagcagagggggactataatgtgatg
gtgatggagctcttggggcccagcctggaagatctcttcaacttctgttcccgcaaattt
agtctcaagacagttctgctcctggcagaccagatgatcagccgtattgagtacattcat
tccaagaacttcattcatcgggatgtaaagccagacaacttccttatgggcctcggcaaa
aaaggcaacctagtatacatcattgattttggtttggccaagaagtaccgagacgcccgg
acccaccagcacatcccttaccgggaaaacaagaatctgactggcacagcccgttacgcc
tctatcaacacccacctgggaattgaacaaagtcgccgtgatgacctggagagcctgggc
tatgtgctcatgtatttcaacctgggttcgctgccctggcagggccttaaggctgccacc
aagcgccaaaagtacgagaggatcagcgagaaaaagatgtcaacgcccattgaggtgctc
tgcaaagggtacccttctgagttctcgacatacctcaacttctgccgttcactgaggttt
gatgataaacctgactactcatacctacggcagctcttccgcaacctcttccaccgccaa
ggcttctcctacgactacgtctttgactggaacatgcttaaatttggagcagcccggaac
cctgaggatatggatcgggagcggcgagagcatgagcgagaagagaggatggggcaactc
cgggggtcagccacgcgagcgctgccccctggcccgcctgctggagccactgccaaccgt
cttcgcaatgtcactgagcccatggcctccacccccacctcccgaatccaacagtccgga
aacacgtcccccagagcaatctcaagagtggacagggagcggaaggtcagcatgaggtta
caccgaggagctcctgccaatgtctcctcatctgacctcacagggcggcaagaagtgtca
cggatttcagcatcacagacaagtgtgccatttgatcaccttgggaagtga

KEGG   Falco peregrinus (peregrine falcon): 101923866
Entry
101923866         CDS       T02856                                 

Gene name
CSNK1G1
Definition
(RefSeq) casein kinase 1 gamma 1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101923866 (CSNK1G1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101923866 (CSNK1G1)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101923866 (CSNK1G1)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   101923866 (CSNK1G1)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 101923866
NCBI-ProteinID: XP_005232644
LinkDB
Position
Un
AA seq 456 aa
MDHPNREKDERQRTTKGMSGRSGHGSRPSSSASSGVLMVGPNFRVGKKIGCGNFGELRLG
KNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSVAEGLPQVYYFGPCGKYNAMVLELL
GPSLEDLFDLCDRTFTLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGNKKEH
VIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMF
MYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPVEVLCENFPEEMATYLRYVRRLDFFER
PDYDYLRTIFTELFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGTSAVTRDSHVHRDRPS
QQALRNQASSDRRGEWEIQPSRQTNTSYLTSHLAADRHGGSVQVVSSTNGELNVDDPTGA
HSNAPITAQAEVEVVEEAKCCCFFKRKRKKTAQRHK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggaccatcctaatagggaaaaggatgaaaggcagcggacgacaaaaggaatgtcggga
aggagtgggcacggttctcgaccaagctcatcagcatcttctggcgttcttatggtggga
cccaacttccgagtgggcaagaagattgggtgtgggaactttggagaactcagactaggt
aaaaatctctacaccaatgaatatgtagcgatcaaactggaaccaataaaatcacgtgca
ccacagcttcatttagaatacaggttttataaacaacttggaagtgtagctgaagggctt
ccccaggtgtattacttcggaccgtgtggaaagtacaacgccatggtactagagctgctt
ggtcctagcttggaagatttatttgacctctgtgataggacgttcactttgaagacggta
ttaatgatagccatccagctgatatctcgaatggagtacgtgcattcaaagaacctcatc
taccgagacgtcaagccagaaaacttccttattggccggcaaggcaataagaaagagcat
gtcattcacatcatagactttggattggcaaaggagtacattgacccggaaaccaaaaaa
cacataccttacagggaacacaaaagcttaactggaacggcaagatatatgtccatcaac
actcatcttggcaaagagcaaagtcgtcgagacgacttggaagctcttggccatatgttt
atgtatttcctccgaggcagtctgccctggcaaggattgaaggctgacaccttaaaagag
aggtatcagaagattggggacacaaagagaaacactccagttgaagttctctgtgagaac
tttccagaggagatggccacgtacctccgttatgttcggcgattagacttctttgagaga
ccagactacgattatttaagaaccatcttcacagagctgtttgaaaagaaaggctacacc
tttgactacgcctatgactgggtcggcaggccaattcctactccagtgggatctgttcat
gtagattctgggacatctgcagtaacaagagacagccacgtccatagagatcgaccatca
cagcaggcccttcgcaatcaggcatcatcagatcgccgaggggagtgggagatccagcca
agccggcagacgaatacctcatacctgacatctcatttggctgcagatcggcatggagga
tcagtacaggtggttagctcgaccaatggggagctcaatgtggatgatccaacgggggca
cactccaacgcgccaataacagcgcaggcagaggtggaggtggtggaggaagctaagtgc
tgctgcttctttaagaggaaacggaagaagacagctcagcgtcataagtga

KEGG   Falco peregrinus (peregrine falcon): 101924206
Entry
101924206         CDS       T02856                                 

Gene name
CSNK1A1
Definition
(RefSeq) casein kinase 1 alpha 1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04310  Wnt signaling pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101924206 (CSNK1A1)
   04340 Hedgehog signaling pathway
    101924206 (CSNK1A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101924206 (CSNK1A1)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101924206 (CSNK1A1)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   101924206 (CSNK1A1)
SSDB
Motif
Pfam: Pkinase Pkinase_fungal PK_Tyr_Ser-Thr Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 101924206
NCBI-ProteinID: XP_013150116
LinkDB
Position
Un
AA seq 276 aa
MDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRH
CNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNL
TGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKM
STPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTML
KQKAAQQAASSSGQGQQAQTPTGKQTDKSKSNMKGF
NT seq 831 nt   +upstreamnt  +downstreamnt
atggatcttcttggtcccagcctcgaagacctattcaacttctgttcccgcaggtttaca
atgaaaacagtacttatgttagcagaccagatgatcagtagaattgaatatgtgcacaca
aagaattttatacacagagacattaaaccagataacttcctaatgggtattgggcgtcac
tgtaataagtgtttagaatctccagtggggaagaggaaaagaagcatgactgttagtact
tctcaggacccatctttctcaggattaaaccagttattccttattgactttggtttggcc
aaaaagtaccgggacaacaggacaaggcaacacataccatacagagaagacaaaaatctc
actggcacagctcgatatgccagtatcaatgcacatcttggcattgagcagagtcgtcgg
gatgacatggaatctttaggctatgtattgatgtactttaacagaaccagtctgccttgg
caaggactgaaggctgcaacaaagaagcaaaagtatgaaaagattagtgaaaagaaaatg
tccactcctgttgaggttttgtgtaagggattccctgcagaatttgccatgtacctgaac
tactgtcgtggcctgcgctttgaagaggcaccagattacatgtatctgaggcaattattc
cgtattcttttcaggaccttgaaccaccaatatgactacacattcgactggacaatgtta
aagcagaaagcagcacagcaggcagcctcttccagtgggcaggggcagcaggcccaaacc
cccacaggcaagcaaactgacaaatccaagagtaacatgaaaggtttctga

KEGG   Falco peregrinus (peregrine falcon): 101924309
Entry
101924309         CDS       T02856                                 

Gene name
CSNK1D
Definition
(RefSeq) casein kinase 1 delta
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
fpg04540  Gap junction
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101924309 (CSNK1D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101924309 (CSNK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101924309 (CSNK1D)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fpg03036]
    101924309 (CSNK1D)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101924309 (CSNK1D)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   101924309 (CSNK1D)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101924309 (CSNK1D)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 101924309
NCBI-ProteinID: XP_005243992
LinkDB
Position
Un
AA seq 398 aa
MFSITLVLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIKWCGAEGDY
NVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMG
LGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLE
SLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRS
LRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRAAEDAERERREREERLRH
TRNPAMRGLPSTASGRLRGTQDVAPPTPLTPTSHAANTSPRPVSGMERERKVSMRLHRGA
PVNISSSDLTGRQDTSRMSTSQIPARVTTSVLQSAVHR
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgttttcaattactctggttttaggaactgatattgctgctggagaggaggttgcaatt
aagttggaatgtgtgaaaaccaaacatcctcagctccacatcgagagtaaaatctacaaa
atgatgcagggtggagtgggcattcccacaattaagtggtgtggagctgaaggggactac
aatgtaatggtgatggagctgttgggaccgagtcttgaagatctcttcaatttttgttca
aggaaatttagtctcaagacagtcctattactcgctgaccaaatgattagtcgaattgaa
tacattcactctaagaacttcatccaccgagatgtgaagccagacaacttcttaatgggc
cttgggaagaaaggcaaccttgtctacataatagactttggattagcaaagaagtatcga
gacgctcgaactcaccaacatattccatatcgtgaaaataaaaacttaacaggaactgcc
cgttacgcatccatcaacactcatcttggaatcgagcaatctcgcagagatgacttggag
tccttgggctatgtactgatgtattttaacctgggctccctcccctggcagggactgaaa
gcagcaacaaagaggcagaaatacgaacgtatcagtgaaaagaaaatgtctacacccatt
gaggttttgtgtaaaggatatccttctgaatttgccacatacttgaatttctgccgttct
ttgcgttttgatgacaaaccggactattcctatctaaggcaattattcagaaacctcttc
caccgacaagggttctcctatgactatgtgtttgactggaacatgctgaaatttggtgcc
agcagagcggctgaagatgctgaacgtgaaaggcgagaacgagaggaaagattgagacat
acacgaaatccagctatgcgtggattaccctccactgcttctggcaggctgagaggaaca
caagatgtagctcctcctactcctcttaccccaacctcacatgctgccaatacctctcct
cggccagtatctggtatggaacgagaaaggaaagtgagtatgagattgcatcgtggtgcc
ccagtaaatatctcatcatctgacttaacaggccgacaagatacctctcgcatgtcaact
tcgcagattcctgctcgggtaactaccagtgttctccagtctgctgtgcaccgatga

DBGET integrated database retrieval system