KEGG   Falco peregrinus (peregrine falcon): 101914457
Entry
101914457         CDS       T02856                                 

Gene name
PTCH2
Definition
(RefSeq) patched 2
  KO
K11101  patched 2
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101914457 (PTCH2)
SSDB
Motif
Pfam: Patched Sterol-sensing MMPL
Other DBs
NCBI-GeneID: 101914457
NCBI-ProteinID: XP_005238550
LinkDB
Position
Un
AA seq 1330 aa
GRAVGQRAPLWLRARFQALLFALGCRIQRHCGKVLFVGLLVFGALAVGLRVASIETDIEH
LWVEAGSRVSQELRYTKEKLGEESVYTSQMLIQTPKREGENILTQEALQLHLEAALAASK
VQVSLYGKSWDLNKICYKSGVPIIENGMIERMIEKLFPCVILTPLDCFWEGAKLQGGSAY
LPGRPDIQWSNLDPLQLMEELGQFTSLEGFKELLDKAEVGQAYMERPCLDPQDPQCPPSA
PNKQSQQSPDIPAELSGGCHGFSRKFMRWQQELILGGTTKDSQGKLLRAEALQTMFLLMS
PRQLFEHFKDDYEIHDISWSEEKAGAILEAWQRKFVELAQNSIPPNATQSVHAFSTTTLN
DIMKSFSDVSAIRVAGGYLLMLAYACVTMLRWDCSKSQGAVGLAGVLLVALSVASGLGLC
SLLGISFNAATTQVLPFLALGIGVDDMFLLAHAFTETSQHIPFKERTGECLKRTGTSVAL
TSVSNMIAFFMAALVPIPALRAFSLQAAVVVVFNFAMVLFVFPAILSLDLHRREKRRLDI
LCCFYSPCSSRVIQIQPQELADANDNHACHPSPYGHPGVATSTQITTTVQAFTRCDPSGH
HVVTVLPPTSQVCTSPAVLLPPTDPLGSQVFTPSSSTRDLLAQLDEAKGGRECVPLPFCR
WSLADFAREKYAPLLLRTRTKAVVVVLFLALLGLSLYGTTMVHDGLYLTDIVPRDTKAHA
FISAQFKYFSFYNMFIVTKGGFHYPGAQAALLSLHQAFSTVKYVVREGNRDLPKMWLHYF
QDWLRGLQATFDRDWQAGRITHDSYRNGSEDGALAYKLLIQTGNKKEPFNFNQLTTRRLV
DENGIIPPDTFYICLTVWASNDPLGFAASQANFYPPPPEWIHDKYDTTGENLRIPAAQPL
EFAQFPFYLSGLRRTADFVEAIESVRAICREAAQRHGVLSYPSGYPFLFWEQYIGLRHWF
LLAISILLACTFLVCALLLLNPWTAGIIVSILAMMAVELFGIMGLMGIKLSAIPVVILIA
SVGIGVEFTVHVALGFLTAVGSKNVRSAAALEHTFAPVMDGAVSTLLGVLMLAGSEFDFI
MRYFFAVLTILTLLGLLNGLVLLPVLLSVIGPPPEASPADNVPRLPPPEPVPPCLGPGGL
YVRRAPAWPATFPDPSDADSMGPGSPRGPFIVPPAPAHILLEAGKDPSFPRITVLKPYKD
SPEVQGKKEAPGPQPAPPLPFGEPCPTPPRDYPQPCAPGARPAPATALPSYSTHLQGPAG
SYTTVTATASVTVALHPTLPGSYPNFGPEGFAGGERDCLEEPSVPSTSGTAGPDTFEMQS
MGRSGAGTRR
NT seq 3993 nt   +upstreamnt  +downstreamnt
ggccgggccgtgggccagagggctccgctgtggctgcgggcccgctttcaggcgctgctc
ttcgccctgggctgccggatccagcggcactgcgggaaggtgctcttcgtggggctgctg
gtgttcggggcgctggccgtggggctgcgggtggcgtccatcgagaccgacatcgagcac
ctctgggtggaagcgggcagccgggtgagccaggagctgcgctacaccaaggagaagctg
ggtgaggagtctgtctacacctcccagatgttgatccagaccccgaagagggagggggag
aacatcctgacgcaggaggccctgcagctccacctcgaggcggccctggccgccagcaaa
gtccaagtctcgctgtacggaaaatcgtgggatttgaacaagatctgctacaagtcgggt
gtccccatcattgagaatggcatgatcgagaggatgatagagaagctgttcccctgcgtg
atcctgacgcccctggactgcttctgggaaggtgccaagctgcagggaggctcagcctac
ctcccgggccgcccggacatccagtggagcaacctggaccctctgcagctgatggaggag
ctggggcagttcacatccctggaaggcttcaaagagctgctagacaaggcagaggtgggg
caggcttacatggagcggccctgcctggatccccaggacccccagtgccccccgagtgcc
cccaacaagcagagtcagcagagccctgacatcccagccgagctttcggggggctgccat
ggcttctccaggaagttcatgcgctggcagcaggagctgattttaggtggcacgaccaaa
gactcccagggcaagctgctacgcgccgaggccctgcagaccatgttcctcctcatgagc
cctcggcagctctttgagcacttcaaagatgactacgaaatccatgacatcagctggagc
gaggagaaggcgggagccatcctggaggcctggcagaggaaattcgtggagctggcacag
aactccatcccacccaatgccacgcagagcgtccatgctttctccaccaccacgctcaac
gacatcatgaagtccttctccgacgtcagcgccatccgggtggctgggggctacctcctc
atgctggcctatgcctgtgtcaccatgctgcggtgggactgctccaagtcccaaggggct
gttggcctggctggggtcctgcttgtggctctgtcagtggcctctggcctggggctttgc
tcactgctgggcatctccttcaatgcagccaccacccaggtcctgcccttcctggccctt
ggcatcggtgtggatgacatgttcctcttggctcatgccttcaccgagaccagccagcac
attcccttcaaggagcggacgggcgagtgcttgaagcgcacggggaccagcgtggctctc
acctctgtcagcaacatgatcgctttcttcatggcagccctggtgcccatccctgccctg
cgtgccttctccctccaggctgcagtggttgtggtgttcaattttgccatggtgctgttt
gtctttcctgctatcctgagcctggacctccaccgccgggagaaacgccggcttgacatc
ctctgctgcttctacagcccttgctcctcgcgggtcatccagatccaaccccaggagctt
gccgatgctaatgacaaccatgcctgccacccgtccccttatgggcaccccggtgtggcc
accagcacccagattaccaccactgtgcaagccttcacccggtgtgacccctcaggccac
catgtcgtcaccgtcctgccacccacctcccaggtgtgcacctcgcctgccgtcctcctg
ccccccacggaccccctgggctcgcaggtcttcaccccgtccagctccacccgggaccta
ctggcccagctggatgaagccaagggtgggcgggagtgtgtccccctgcccttctgccgc
tggagcctggctgactttgcccgggagaagtacgccccgctcctcctgcggacccggacc
aaggcagtggtggtggtgctcttcctggcgctgctggggctgagcctctacggcaccacc
atggtgcacgatgggctctatctgacggacatcgtgccacgggacaccaaggcgcatgcc
ttcatctcagcccagttcaagtacttctccttctacaacatgttcatcgtcaccaagggt
ggcttccactacccaggtgcccaagccgccctgctcagcctgcaccaggccttcagcacc
gtcaagtatgtggtgcgggagggcaaccgtgacctgcccaagatgtggctccattacttc
caggactggctgcgtgggctccaggccaccttcgacagggactggcaagctgggcgcatc
acccatgacagctaccgcaacggctctgaggatggggcgctggcatacaagctcctaatc
cagactggcaacaagaaggagcccttcaacttcaaccagctgaccacccggcggctggtg
gatgagaatggcatcatcccccctgacaccttctacatctgcctgacggtgtgggccagc
aacgaccctctgggcttcgctgcctcccaggccaacttctaccccccgccaccggagtgg
atccatgacaagtacgacaccacgggcgagaacctgcgaatcccagcagcccagcccctg
gagttcgcccagttccctttctacctgagcgggctgcgtcgcacagctgactttgtggag
gcgatcgagagcgtgcgggccatctgccgggaggctgcccagcgccacggggtactgagc
taccccagcggctaccccttcctcttctgggagcagtacattggcctgcgccactggttc
ctgctggccatcagcatcctgctggcctgtaccttcctcgtctgtgccctgctgctgctc
aacccctggacggccggcatcatcgtctccatcctggccatgatggcagtggagctgttt
ggcatcatggggctgatgggcatcaagctaagcgccatccctgtggtcatcctcatcgcc
tcagtgggcatcggtgtagagttcactgtccatgtggccctgggcttcctgacagctgtg
gggagcaagaacgtgcgctcagctgcagcactggagcacacctttgcccccgtgatggat
ggtgctgtctccacactcctgggcgtcctcatgttggctggctcagagtttgacttcatc
atgaggtacttctttgcggtgctcaccatcctgacgctgctggggctgctgaatgggctg
gtgctactgccagtcctgctctctgtcattgggccaccccctgaggcatccccggctgat
aacgtcccccgcctgcccccaccagagccggtgcccccatgcctgggccctggggggctg
tatgtccggcgtgccccagcatggcctgccaccttccctgacccctcggacgcagatagc
atgggaccaggcagcccccgggggccgttcattgtgcccccagccccggcacacatcttg
ttggaggccggcaaggaccccagcttccctcgcatcaccgtgctgaaaccctacaaggac
agcccagaggtccaggggaagaaggaggctcccggcccacagcccgcaccgcccctgccc
ttcggggagccgtgccccacaccaccccgagattacccacagccctgcgcaccgggcgcc
cggccagcccccgccacagccctgccctcctacagcacccacctgcagggtcctgccggc
agttacaccaccgtcactgccactgcttcggtgacggtggccctgcaccccacactgcct
ggctcctaccccaactttggccccgagggctttgctggtggcgagcgggactgcctggag
gagcccagtgtacccagcaccagtggcactgctgggcctgacaccttcgagatgcagagc
atgggacgcagcggggcaggcacccggcgctag

KEGG   Falco peregrinus (peregrine falcon): 101915344
Entry
101915344         CDS       T02856                                 

Gene name
PTCH1
Definition
(RefSeq) patched 1
  KO
K06225  patched 1
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101915344 (PTCH1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 101915344
NCBI-ProteinID: XP_005240746
LinkDB
Position
Un
AA seq 1291 aa
MFNPQLMIQTPQEDGANVLTTEALRQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELIT
EAGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLQWINFDPLEFLEELKKI
NYQVESWEEMLNKAEVGHGYMDRPCLNPADPDCPITAPNKNSTKPLDVAFFLSGGCYGLS
RKYMHWQEELIIGGTVKNSSGKLVSAQALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDK
AAAILEAWQRMYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLA
YACLTMLRWDCAKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVG
VDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALR
AFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVTRVIQVEPQAYA
ENDNTCYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTQVYYTTAEPRSEISVQPVTV
TQDNLSCQSPESTSSTRDLLSQFSDSSMHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKIV
VIFLFLGLLGLSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADY
PNVQHLLYELHRSFSNVTYVLLEEDRQLPKMWLHYFRDWLQGLQDAFDSDWETGKITYNN
YKNGSDDAVLAYKLLVQTGNRAKPIDISQLTKQRLVDADGIINPNAFYIYLTAWVSNDPV
AYAASQANIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQFPFYLNGLHETSDFVEAIE
KVRAICSNYTSLGITSYPNGYPFLFWEQYIGLRHWLLLSISVVLACTFLVCALFLLNPWT
AGIIVVVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDRN
HRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLP
VLLSFFGPYPEVSPANGRNRLPTPSPELPPSIVRFALPPGHTNNGSDSSDSEYSSQTTVS
GISEELHQYEATQGPGAPVHQVIVEATENPVFARSTVVQPETSNQSSPRLQSNPESGTQQ
AWCQGRQPKREVREGLRPPPYRPRRDAFEISTEGHSGPNNRDRLGHRARSHNMRNPAFGT
VGAMGPSYCQPITTVTASASVTVAVHPAVHSHSPRGGSFPSYEGCHEADQGPFEDPHVPF
NVRCDRRNSKIEVIELQDVECEERIPGNSSQ
NT seq 3876 nt   +upstreamnt  +downstreamnt
atgtttaacccccagctcatgatccagactccacaggaagatggtgctaatgtactaaca
acagaggcactccgacagcaccttgactctgcgcttcaggccagcagagtacatgtctat
atgtacaacagacagtggaaattggaacatttgtgttataaatcaggagaactcatcaca
gaggcaggttatatggaccagatcatagaatacctttatccttgcttaattatcactcca
ttggactgcttctgggagggagcaaagctacagtcaggaactgcctatctattaggaaag
cctcctttgcagtggatcaactttgaccccttagaattcctggaagagttaaagaaaata
aactaccaagtggagagctgggaagaaatgctgaataaagcagaggttggtcatggttat
atggatcgaccttgcctgaatcctgctgatcctgattgcccaatcacagctcccaataaa
aattccaccaaacctcttgatgtggccttctttttgagtggtggatgctatggactgtca
agaaaatacatgcattggcaggaggagttaattattggtggtacagtcaagaacagttct
ggtaaacttgtcagtgcccaggctttgcagaccatgtttcagttaatgactcctaagcaa
atgtatgagcacttcaaggggtatgaatatgtttcacatatcaactggaatgaggataag
gcggcagcaattctagaagcctggcagaggatgtatgttgaggttgttcatcaaagtgtt
gcacaaaactctactcagaaagtgctctcctttactacaaccactctggatgacatcctg
aagtcattttctgatgtcagtgttatcagagtagcaagtggctacttgttaatgcttgcc
tacgcctgtttaacaatgctgcggtgggactgtgccaagtctcagggtgccgtggggctg
gcaggagtcttgttggttgcactctcagtggctgcaggattgggcctgtgctcattgatt
ggaatttcctttaatgctgccacaactcaggttttgccttttcttgctcttggagttggt
gtagatgatgttttccttctggcacatgcatttagcgaaacagggcagaataagagaatt
ccatttgaggacagaacaggtgaatgtttgaagcgaacaggggcaagtgtagcccttaca
tctatcagcaatgttactgctttctttatggctgccttaatccctattcctgctttacga
gcattttcactccaagcagcagttgtggtggtgttcaactttgctatggttctgctgatt
tttcctgctatcctgagtatggacctttatcgtcgagaagacaggagactggatatattc
tgctgttttacaagtccatgtgtcactcgagtgattcaggttgagcctcaagcatatgca
gaaaatgacaatacttgctacagtcctccacccccgtacagcagtcacagttttgcacat
gaaactcagattacaatgcagtctacagtgcagttgcgcacagaatacgatcctcatacg
caggtgtactataccacagcagagcctcgttcagaaatatctgtgcagccagttacagtg
acgcaagataatcttagctgccagagcccagaaagcacaagctcaacgagggatttgctt
tcccagttctcagactccagcatgcattgccttgagccaccctgtacgaagtggacactc
tcatcttttgcagaaaagcattatgctccgttcctcctaaaaccaaaagctaagattgtg
gttatttttctttttctgggtttactggggctcagcctttatggaactacccgggtgaga
gatggactagatctcacagacattgtaccacgggaaacacgggaatatgactttattgcc
gcacagttcaagtacttttcattctacaatatgtatattgtgacacagaaagcagattat
ccaaatgtccagcacttactttatgaacttcacagaagtttcagcaatgtgacatatgtt
ctgttggaagaggataggcagcttcccaaaatgtggttgcactactttcgagactggctg
caaggacttcaggatgcatttgacagtgactgggaaactgggaagatcacttacaacaat
tataaaaatggatctgacgatgctgttttggcttacaaactcttggtacaaacaggcaac
cgagcaaagcccattgacatcagccagttgactaaacagcgtttggtggatgcggatgga
atcattaacccaaatgctttttacatctacctgacagcctgggttagcaatgaccctgtg
gcctacgcagcctcacaagccaacatccggcctcaccgcccggagtgggtccacgacaaa
gcagactatatgccagaaacaaggctgagaattccagcagctgagcccatagaatatgct
cagtttcctttctacctcaacggactgcatgaaacttctgactttgtggaggctattgag
aaagtgagagctatctgtagtaactacaccagcctggggatcaccagctacccaaatggt
tacccatttctgttttgggagcagtacattgggcttcgtcactggctccttttatccatt
agtgtggttttggcttgcacgtttctggtgtgtgccctcttcctcctaaacccctggaca
gctgggatcattgtggtggtgctggctctgatgactgtggagctgtttggcatgatgggt
ctaattggaataaagctgagtgcagtgcctgtggttatcctgattgcttctgttggcatt
ggtgtggaattcactgttcatgttgctttggcatttttaactgccataggagacaggaac
cacagggctgtccttgcattggaacacatgtttgcaccagtgctggatggggccgtgtcc
actctgcttggagtgttaatgcttgcaggatcagagtttgattttatcgtcaggtatttc
tttgctgttttggcaatcttaaccattctgggagttctcaatggattggtgttgcttcct
gttcttctttcattctttggaccgtaccctgaggtttctccagccaacggacgaaacaga
ttgcccacaccgtctcccgagctgccccccagcatcgtgaggtttgcactgccacctggg
cacacaaacaatgggtcagattcctctgattcggagtacagctctcaaaccacagtgtct
ggcatcagtgaagagcttcatcagtatgaggccacccaaggccctggggcaccagtccat
caagtaatagtggaggccactgagaatcctgtctttgcgagatccactgtggttcagcca
gagacaagtaatcagtcaagtcccagattacaatcaaatccagagtctggcacacagcag
gcatggtgtcagggcagacaacccaaacgggaagtgcgggaagggctgcgaccacctcct
taccgccctcgcagggatgcttttgaaatttctactgaagggcattcaggacctaacaat
agggatcgcttgggccacagggctcgttctcacaacatgagaaacccggcgttcggcact
gtgggtgccatgggaccatcgtactgccagcctatcactactgtgactgcctcagcttca
gtgactgttgctgtccaccctgcagtgcacagccacagccctcggggagggagctttcca
tcctacgagggatgccatgaagctgaccaggggccatttgaggacccccatgtgcctttt
aatgtgcggtgcgacagacgaaattctaaaatagaggttatagaactgcaagatgttgaa
tgtgaggaaaggatacctggcaacagctcacagtaa

DBGET integrated database retrieval system