KEGG   Falco peregrinus (peregrine falcon): 101914651
Entry
101914651         CDS       T02856                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
fpg04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101914651 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101914651 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fpg04052]
    101914651 (KITLG)
Cytokines and growth factors [BR:fpg04052]
 Growth factors
  Growth factors (RTK binding)
   101914651 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 101914651
NCBI-ProteinID: XP_013158865
LinkDB
Position
Un
AA seq 348 aa
MANQFSSGKSEGGTMLEMGKTNKNVLSYRLNTVFTQDAKGSSVLKNLQDHLCRSIRRHCS
TTFLWLQQTWIITCFCLQLLLLNPLVKAQNSCGNPVTDDVNDIEKLVGNLPNDYMITLKY
VPKMDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIINDLMAC
LAFDKNKDFVKENGHLYEEGRFIPEDFFRHFNSTIEVYKEFADTLYKNDCILPSTVETPE
NDSRVAVTKTFLFPPVAASSLRNDSIGSNTNSNKEALGFISSSSLQGISIALTSLLSLLI
GFILGAIYWKKTHPKSRPESDETTQCHDCQEENEISMLQQKEKEHLQV
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggctaaccagttctcatctggtaaatcagaaggtggtactatgctagaaatgggcaag
actaataaaaacgtgctttcttacagactaaacacggtgtttacacaggatgcaaaaggt
agtagcgtgttaaaaaacctgcaggatcacctttgcagaagcattaggaggcactgctca
acaacttttctgtggcttcagcagacttggattatcacctgcttttgtcttcaactactc
ctacttaatccgcttgtcaaagcccagaattcctgcgggaatccagtgacagatgatgtg
aatgacattgaaaaattggttggaaatctcccaaatgattatatgataactcttaaatat
gtcccgaagatggatagtctgcctaatcactgctggttgcatttgatggtgcctgaattt
tcaagaagtctacataatcttctccagaagttttcagatatttcagatatgtctgatgtt
ttaagcaattattcaatcatcaataatctcacaaggataattaatgatcttatggcatgc
ctagcttttgataaaaataaggattttgtaaaagaaaatggtcatctttatgaagaaggt
cgcttcattcctgaggatttttttaggcacttcaatagtaccattgaggtctacaaggag
tttgcagacacattgtataagaatgactgcattctgccttcaacagtagaaacaccagaa
aatgattccagagtcgctgtcacaaaaacatttttgtttcctcctgttgctgccagctcc
cttaggaatgacagcattggcagtaacactaacagtaacaaagaggcacttggcttcatt
agcagctccagcctgcaagggatcagcatagcactgacatcattgctgtctcttcttatt
ggctttattttgggagccatatactggaagaaaacacatcccaaatccagaccagaaagt
gatgaaactacacagtgtcatgactgtcaagaggaaaatgagataagtatgttgcagcaa
aaagaaaaggaacatctacaagtgtag

DBGET integrated database retrieval system