KEGG   Falco peregrinus (peregrine falcon): 101915163Help
Entry
101915163         CDS       T02856                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
fpg04068  FoxO signaling pathway
fpg04110  Cell cycle
fpg04115  p53 signaling pathway
fpg04210  Apoptosis
fpg04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101915163 (GADD45G)
   04068 FoxO signaling pathway
    101915163 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101915163 (GADD45G)
   04210 Apoptosis
    101915163 (GADD45G)
   04115 p53 signaling pathway
    101915163 (GADD45G)
   04218 Cellular senescence
    101915163 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fpg03036]
    101915163 (GADD45G)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     101915163 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101915163 (GADD45G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 101915163
NCBI-ProteinID: XP_005239899
LinkDB All DBs
Position
Un
AA seq 157 aa AA seqDB search
MERGESLMDLERLEVGSTPPKPKGMDLRVSALRRACLTAGAYESAKLMNVDPDNVAFCVL
AADEEDEGDIALQIHFTLIQAFCCENDIDIVRVNDVAKLAAIVGPSEEPGEPRDLHCILI
TNPDEDGWKDPALEKLNLFCEECRNVNDWVPTITLPE
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaggagagtctctgatggatttggaaagacttgaggttgggagtactccacct
aaaccgaaagggatggacctgcgggtgtcggcgctgcgccgcgcctgcctcaccgccggg
gcctacgagtcggccaagctgatgaacgtggaccctgacaacgtcgccttctgcgtgctg
gccgcagacgaggaggacgagggggacattgccctgcagatccacttcaccctgatccag
gccttctgctgcgagaacgacattgacatcgtgcgagtgaacgacgtggccaagctggct
gccatcgtggggcccagcgaggagcccggcgagccgcgggacctgcactgcatcctcatc
acgaacccagatgaagatggctggaaggaccctgcccttgaaaagctgaacttgttttgt
gaggagtgccgaaatgtcaatgactgggtaccaactattaccctgcctgagtga

DBGET integrated database retrieval system