KEGG   Falco peregrinus (peregrine falcon): 101915804Help
Entry
101915804         CDS       T02856                                 

Gene name
CNIH4
Definition
(RefSeq) cornichon family AMPA receptor auxiliary protein 4
  KO
K20368  protein cornichon
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Membrane trafficking [BR:fpg04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    101915804 (CNIH4)
Transporters [BR:fpg02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   101915804 (CNIH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 101915804
NCBI-ProteinID: XP_005241903
LinkDB All DBs
Position
Un
AA seq 159 aa AA seqDB search
MYTFLNNKTVYAESRVLSPSYWVKIDALYILSCHTIFPYLGLQIITLSDLECDYINARSC
CSKLNKWVVPEVIGHAVVTVLMLISLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTE
IHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtacacgtttctaaacaacaagacagtctatgctgagagcagagtgctgtccccaagt
tactgggtaaaaatagatgctttgtatattctgagttgccacacaatttttccttatctt
ggacttcagataattacactatcagatttggaatgtgactacattaatgctagatcatgc
tgctcaaagctcaataaatgggtggtccctgaggtgattggccatgctgtcgtaactgta
ttaatgcttatttcattgcactggttcatctttctccttaatttgccagtagcaacatgg
aatatatataggtacattatggttccaagtggaaacatgggggtatttgatcccacagag
atccataaccgaggacaactgaaatcacacatgaaggaagccatgattaaactaggcttt
catctgctgtgtttcttcatgtacctttacagtatgattctggctttgataaatgattga

DBGET integrated database retrieval system