KEGG   Falco peregrinus (peregrine falcon): 101916035Help
Entry
101916035         CDS       T02856                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00480  Glutathione metabolism
fpg00980  Metabolism of xenobiotics by cytochrome P450
fpg00982  Drug metabolism - cytochrome P450
fpg00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101916035 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101916035 (MGST2)
   00982 Drug metabolism - cytochrome P450
    101916035 (MGST2)
   00983 Drug metabolism - other enzymes
    101916035 (MGST2)
Enzymes [BR:fpg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101916035 (MGST2)
Transporters [BR:fpg02000]
 Other Transporters
  Pores ion channels [TC:1]
   101916035 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 101916035
NCBI-ProteinID: XP_005239904
LinkDB All DBs
Position
Un
AA seq 147 aa AA seqDB search
MAGDSALLAAVSLLSAFQQCHFAWLVGKSRMKHKVMPPAVTGAPEFDRTFRAQQNCVEFY
PIFLTVLWTAGWFFNQELASFLGVLYVFARYKYFHGYVQSVKGRLTGFYLNLIILTCLIT
LGAAGIINSFLDEYLDFSIMKKLSKLF
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgattcagctttgcttgcggctgtctctcttctttctgccttccagcaatgt
cattttgcttggctggtggggaaatcaagaatgaagcacaaggtcatgccccccgctgtc
actggggctccagagtttgacagaacatttcgtgcacaacaaaactgtgtggagttttac
ccaatattcctgactgtcctctggactgcaggatggttttttaatcaagaattagcttcc
tttctgggtgtgttgtacgtgtttgcccgctacaagtacttccacggttacgtacagtct
gtgaaaggaaggttaacaggtttctatttgaatttgataattctaacttgcttgataacc
ctgggtgcagctgggattattaacagctttctggatgaatacctagacttcagcattatg
aagaaactgagtaaattgttttga

DBGET integrated database retrieval system