KEGG   Falco peregrinus (peregrine falcon): 101916111Help
Entry
101916111         CDS       T02856                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00020  Citrate cycle (TCA cycle)
fpg00190  Oxidative phosphorylation
fpg01100  Metabolic pathways
fpg01200  Carbon metabolism
Module
fpg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fpg_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101916111 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101916111 (SDHA)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101916111 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 101916111
NCBI-ProteinID: XP_005242930
LinkDB All DBs
Position
Un
AA seq 652 aa AA seqDB search
MGVELPQSVWPAACQTLARNLHFTVYGKKNASTKVSDSISTQYPVVDHEFDAVVVGAGGA
GLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNWRWHFYDTVKGSDW
LGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQFGKGGQAHRCCCV
ADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGTIHRFRAKNT
VIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCR
GEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDHVYLQLHHLP
PQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVITHVNGEDKVV
PGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAETCKPGEPVPSIKPNAGEES
VANLDKLRFANGTIRTSEVRLNMQKAMQNHAAVFRTGSVLQEGCEKLSQIYSDLAHLKTF
DRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKLRIDEFDYSKPLQG
QQRKPFEEHWRKHTLSYVDIQSGKVTLKYRPVIDRTLNEEDCSTVPPAIRSY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtggaactgccccaaagtgtgtggccagcggcatgccagactcttgcacgtaat
ttacacttcacagtctatggaaagaaaaatgcttctacgaaggtttctgattcgatttct
acacaatatccagtagtggaccatgaatttgatgcagttgttgtgggtgcaggaggagca
ggtctgcgggctgcatttggtttgtcagaagctggatttaatacagcatgtgttacaaag
ctgtttcccaccagatctcatactgttgctgcacagggagggatcaacgctgctttggga
aacatggaggatgataactggaggtggcatttctatgacacagtgaaagggtctgattgg
ctgggtgaccaggatgccatacactacatgactgagcaagccccggctgcggtgatagag
ctggaaaattatgggatgccgttcagcagaactgaagaaggaaaaatctatcagcgtgca
tttggtggacagagtcttcagtttggaaaaggaggacaggctcacagatgctgttgtgtt
gcagacaggacaggacactcactgttacatactctgtatggcaggtccctaagatacgat
acaagctactttgttgaatattttgccttggacctccttatggagaatggagaatgtcgt
ggtgttattgccctttgcatagaagatggcactatacatcgttttagagcaaagaacact
gtcattgccacaggtgggtacggccgcacttacttcagttgtacatctgctcatactagt
acgggtgatggcactgctatggttacacgagctggtcttccatgccaggacttggaattt
gtacagtttcaccctacaggtatctatggggctggctgccttataacggaaggatgtcgt
ggagagggaggtattctaattaacagtcaaggggaaagatttatggagagatacgcacct
gttgctaaggatctggcttccagggatgtagtgtctcgttctatgaccatagaaatccgt
gaaggaaggggttgtggtcctgaaaaagaccatgtatacttgcagttgcaccacctacca
ccacagcagctagcaacccgtctcccaggaatttcggaaacagctatgatatttgctgga
gttgatgtcactaaagagcctattcctgttctgcctactgtgcattataatatgggaggt
attcctactaactacaaaggacaggtcattacacatgtgaatggtgaggataaagtcgta
cctggtttatatgcttgtggggaagcagcctctgcatctgtccatggcgcaaatcgactt
ggagcaaactcacttctggatttagtggtttttggtcgtgcttgtgcccttactattgca
gagacatgcaagcctggagagccagttccctccattaaaccaaatgctggtgaagagtca
gttgctaatcttgacaaattaagatttgctaatggaaccataagaacttcagaagtgcga
cttaacatgcagaaggcaatgcaaaaccatgctgctgtatttcgtactggttctgtactc
caagaaggctgtgaaaaacttagccaaatttatagtgatctggctcatctaaagacattt
gacagaggtattgtgtggaacactgacttggtggagacccttgaactgcaaaacctgatg
ctttgtgctctacaaaccatttatggtgcggaggctcgcaaagaatcccggggtgctcat
gccagagaggactataagttacggatagatgagtttgactattctaagccactccaaggc
caacagcggaagccatttgaagagcactggagaaagcacaccctttcatatgtggatata
caatctgggaaggttaccctgaaatacagacctgtgatcgacagaacgttgaatgaagaa
gactgctcaactgtcccacctgctattcgctcatactag

DBGET integrated database retrieval system