KEGG   Falco peregrinus (peregrine falcon): 101916338Help
Entry
101916338         CDS       T02856                                 

Gene name
C8G
Definition
(RefSeq) complement C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
fpg  Falco peregrinus (peregrine falcon)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin
Motif
Other DBs
NCBI-GeneID: 101916338
NCBI-ProteinID: XP_005231414
LinkDB All DBs
Position
Un
AA seq 158 aa AA seqDB search
MQLAGRWFLVGMASCCSYLAEHSHRLEATAVTVTILDGQSLAISTFRKLDGMCWEIRQRY
LPAQAHGRFLLKGRGYGSKVDVVVGETDHSSYAILYYQKGRSISVKLYGRTSRVSDTVAD
KFEQHVRAVGLSEDVTYYFPTYGFCDSADEFHTLDGEL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttgcagggaggtggttcctggttggcatggcctcctgctgcagctacctggca
gagcacagccacaggctcgaggccacggcggtgacggtgaccatcctggatgggcagagc
ctggccatcagcaccttcaggaagctagacgggatgtgctgggaaatcaggcagcgctat
ctccctgcccaggcccatggacgcttcctcctgaaaggtcgtgggtatggcagcaaagtg
gacgtagtggtgggtgagacagaccacagcagctacgctatcctctattaccagaagggc
cgaagcatctctgtcaaactctatggacggaccagccgggtcagtgacactgttgcggac
aagtttgagcagcatgtcagagctgtgggcctgagcgaagatgtgacctactacttcccc
acatacgggttttgcgactctgcagacgagtttcacacccttgatggtgagttgtga

DBGET integrated database retrieval system