KEGG   Falco peregrinus (peregrine falcon): 101916694
Entry
101916694         CDS       T02856                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
fpg04020  Calcium signaling pathway
fpg04260  Cardiac muscle contraction
fpg04261  Adrenergic signaling in cardiomyocytes
fpg04270  Vascular smooth muscle contraction
fpg04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101916694 (CACNA1C)
   04020 Calcium signaling pathway
    101916694 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101916694 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101916694 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    101916694 (CACNA1C)
   04270 Vascular smooth muscle contraction
    101916694 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fpg04040]
    101916694 (CACNA1C)
Ion channels [BR:fpg04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101916694 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 101916694
NCBI-ProteinID: XP_005234774
LinkDB
Position
Un
AA seq 2041 aa
MPVDHLPSSFTQDSAVERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIV
VVGLFSAILEQATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIK
AMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAH
GRQCQNGTECKAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGRDWPW
IYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWIT
QAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTDNVPGADIEGENCGARLAHRISKSKF
SRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKV
LLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCV
RLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEM
QTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNY
ILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIEKAAVEEETKEE
KIELKSITADGESSPATKINMDDYQPNENDEKSPYPTSEVPAEEDEEEPEMPVGPRPRPM
SELHLKEKAVPMPDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDP
VRHLSFRNQILFYFDIVFTVIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGAFLHKG
SFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCV
FVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTAAECRGYYITYKDGEVN
QPMIQPRSWENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEI
SIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRY
IPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCMFKEAMNILNMLFTGLF
TVEMVLKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGS
IVDIAITEVNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFI
KSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCAT
GEAWQEIMLACLPDKKCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIINLFVAV
IMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLC
PHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWK
RTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAG
LRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDG
RSAFPQTFTTQRPLHINKSGNNQGDTESPSHEKLVDSTFTPSSYSSSGSNANINNANNTA
LCRFPSPPSYPSTVSTVEGHGTPLSPTICVQEAPWKLPSKSSSSRDSQLAIVCQEEVSQD
EAYDENLNEDIEYCSEPSLLSTEMLAYQDDENRQLTPPENNKGEDTRHSPKKGFLCSSAL
GRRASFHLECLKRQKNQGVDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHSPTMFSRLCA
TPPATPCSRGWPQQTIPTLRLDRAESSEKLNSSFPSVHCSSRYPDNTGCSSPRRARPVSL
TVPSQTGGSSRQFHGSAGSLVEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMEN
AADNILNGNSKQSPNGNLLPFVNCRDPGQDSAGEEEEEVQNPDCRISQEELKDSRIYISS
L
NT seq 6126 nt   +upstreamnt  +downstreamnt
atgcctgttgaccatctcccctcctccttcacacaggactctgcagtggaacgagtggag
tatctctttctcataatttttacagtggaagcatttttaaaagtaatagcatacggactt
ctctttcaccccaacgcttacctccgcaatggctggaatttactagattttataattgtg
gtagtagggctttttagtgcaattttagaacaagcaaccaaagcagatggggggaattca
ataggaggaaaaggtgccggatttgatgttaaagcactgcgggctttcagagtattacgt
ccattacggctggtgtctggagttcctagtctccaggtggttttaaattcaattatcaag
gccatggtccctttgttgcacattgccctgctggtgctgtttgtcattattatctatgcc
atcattggactggagttattcatggggaagatgcataagacctgctaccatgttcaaggg
ggactgatagatacacctgcagaagatgatccatctccctgtgccccccagtctgcgcat
gggcggcagtgtcagaatggcacagagtgcaaagcaggctgggagggacctaagcacggc
attacgaactttgacaattttgcttttgccatgctgacggtgtttcagtgcatcacaatg
gagggctggacagatgtactgtactgggtcaatgatgccataggaagggactggccctgg
atctattttgttacactaatcatcatagggtcattttttgtacttaacttggttctcggt
gtacttagcggggagttttccaaagaaagagagaaggctaaggctcggggtgatttccag
aagttacgggaaaaacaacagctagaggaggatttgaagggatacttagactggataact
caagcagaagatattgacccagaaaatgaagatgaaggcatggatgaggagaagcctcga
aacatgagcatgcccaccagtgagaccgagtccgtgaacacagacaacgtccctggagca
gatattgaaggcgaaaactgcggtgctaggctagcgcatcggatctcaaaatcaaagttt
agtcgctactggcgccgatggaatcgattctgcagaagaaagtgccgtgccgctgtcaag
tccaatgttttctactggttggtgatcttccttgtgtttctcaacacccttaccattgcc
tctgagcactacaaccagccagactggctcacggaggtccaagacactgccaataaggtg
ctgctagctctgttcacggcagagatgctgctgaagatgtacagccttggtctccaggcc
tattttgtgtccctcttcaaccgctttgactgtttcattgtatgtggaggaatcctggaa
actattctggttgagacaaagatcatgtcaccactgggcatttcggtgttgagatgtgtt
cgactcctaagaatatttaaaatcacaagatactggaactccctcagtaaccttgtggct
tcactcctgaattcagtccgctccattgcctccctgttgctgcttctcttcctcttcatt
atcatcttctctctcctggggatgcagctctttgggggcaagtttaattttgatgagatg
cagaccaggaggagtacattcgacaacttccctcagtcactcctcactgtgtttcagatc
ctgactggggaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccc
tcttttccaggaatgttggtctgtatttacttcatcatcctcttcatctgtggaaactat
atcttactgaatgtatttttggccattgctgtggacaaccttgctgatgctgagagttta
acatctgcacagaaagaggaagaagaagaaaaagaaaggaagaagctagctaggactgct
agtccagaaaagaaacaggagatagaaaaagcagctgtggaggaggagacaaaagaggag
aaaattgagctgaaatcgatcactgctgatggagaatcctcacctgctaccaagatcaac
atggatgattatcaacccaatgaaaatgacgaaaagagcccatatcccacatcagaagtg
ccagcagaggaagatgaggaagaacccgagatgcccgtcggccctcggcctcgcccgatg
tctgagctgcacctcaaggaaaaggctgtgcctatgcctgatgccagtgcttttttcatc
ttcagtcctaacaacaggtttcgtgtccactgccatcgaatcgttaacgataacattttc
accaacctgatcctatttttcatcttgctcagcagcatctccctggcagctgaggacccc
gtccgacacctctcctttaggaaccaaattctcttttattttgatatagtttttactgtc
attttcaccattgaaattgctctgaagatcctaggcaatgcagactatgtcttcactagt
atctttacattagaaattattcttaagatgactgcgtatggggctttcctccataagggc
tctttctgcagaaactatttcaacatcttagacctgctggtggtcagcgtttctctcatc
tcctttgggatccagtccagtgccatcaatgtggtgaagatcctgcgtgttctgcgagtc
cttagacctctgagggccatcaacagagccaaaggactaaagcatgtggtccagtgtgtg
tttgtcgccatccgaaccatcggaaacattgtgattgtcaccactttgctgcagttcatg
tttgcctgcattggagttcagttgtttaagggtaagctgtacagctgcactgatagctcc
aagcagacggcagcagagtgcagagggtactatattacatacaaagacggtgaggtcaac
cagccgatgatacagccccggagctgggagaacagcaagtttgactttgacaacgtcttg
actgccatgatggccctcttcactgtctcaacctttgagggctggccagagttgctgtat
aggtccattgattcccacatggaggatgtgggacccatctataatcacagggttgagatc
tccatcttctttattatctacatcatcatcattgctttcttcatgatgaacatcttcgtt
ggtttcgtcatcgtcacatttcaggaacaaggagaacaagagtacaagaactgtgagctg
gacaaaaaccagcgccagtgtgtagaatatgccctgaaagcccggcctctgcggagatac
atccctaaaaaccagtaccagtacaaagtttggtatgtggtcaactccacctattttgaa
tacctgatgttcgttctgattctgctgaacaccatctgcctggccatgcaacactacggt
cagagctgcatgttcaaggaagccatgaatatcctcaacatgctcttcactggcctcttc
actgttgagatggtcctgaaattaatcgctttcaaacccaagggttactttagtgatcct
tggaatgtttttgacttcctcatcgtaattggcagcattatagacgtcattctcagtgaa
actaatcactatttctgtgatgcatggaatacatttgacgccttgattgttgtgggtagc
attgttgatatagcaatcaccgaggtgaacccagctgaacatacccaatgctcttcctct
atgaatgcagaggaaaactctcgcatctcaatcaccttcttccgactcttccgcgtgatg
cgtctcgtgaagctcctgagccgaggggagggcatccggacactgctttggaccttcatc
aagtccttccaggctctcccctatgtggctcttttaatagtgatgttgttcttcatctac
gctgtgatcgggatgcaggtgtttggtaaaattgcgctgaatgataccacagaaatcaac
cgcaacaacaacttccagaccttcccccaggcagtgctgctgcttttcaggtgtgccacc
ggtgaggcctggcaggaaatcatgctggcatgtctcccagacaagaagtgcgacccagag
tcagagccagccaactccaccgaagccgatcactcttgtggcagcagcttcgccgttttc
tatttcatcagcttctacatgctctgtgccttcctgatcatcaatctttttgtagctgtt
ataatggataactttgattacctgacacgggactggtccattttaggaccacaccacctg
gatgagtttaaaagaatctgggcagagtatgaccctgaagccaagggacggatcaaacac
ttggacgtggtgacgctgctccggcggattcagccccccctgggcttcgggaagctctgc
cctcaccgggtggcttgcaaacgccttgtctccatgaatatgccactgaacagtgatggg
accgtcatgttcaatgccactctctttgcgttagtcagaacagcattgaggatcaagaca
gaaggtaacctggagcaagccaacgaagagctgagagcaataattaagaaaatctggaag
cgcaccagtatgaagctgctggaccaggtggtgccccccgcaggcgatgacgaggtgacc
gttggaaagttctatgccacttttctgattcaggagtacttccggaagttcaagaaacgt
aaagaacaggggctggtgggcaagccctcccagcgcaacgcactgtccttgcaggctggc
ctgcgcacacttcatgacattgggccagagatccgacgagcaatttctggagacctgaca
gctgaagaagagctagataaggccatgaaagaagctgtttctgctgcctctgaagatgat
atcttccggagagctggaggcttgttcggaaaccatgtcagctattaccaaagtgatggc
aggagtgcgttcccccagacattcaccacccagagacctttgcacatcaataagtctggc
aacaaccagggagataccgagtctccatctcatgagaagctggtggactccaccttcact
cccagcagctactcatcttcaggctccaatgccaacatcaacaatgccaacaacactgcc
ctgtgccggttccccagcccacccagctaccccagcactgtcagcacagtagaaggccat
gggacccccttgtcacccaccatatgtgtgcaggaggctccttggaaactaccttccaaa
agctccagttccagagacagccagctggcaattgtttgccaagaggaagtgtctcaggat
gaggcttacgatgaaaatttgaatgaagacattgagtactgtagtgaaccaagtctgctc
tctaccgaaatgcttgcataccaagatgatgaaaacagacaacttactccaccagaaaac
aacaaaggagaggacactcggcactctccgaagaaagggtttctgtgctcttcagcgcta
ggtcgaagagcatcttttcacttagagtgtctgaaaagacagaaaaaccagggcgtagat
gtctcgcagaagacagttctgcctttgcatctggtacatcatcaggcattagcagtggcc
ggcctgagtcccctactccagcgaagccattcccccaccatgttctctcggctgtgtgct
acaccccctgctacaccctgcagccgtggctggccgcaacagaccatcccgactctgcgc
ctcgacagggcagagtccagcgagaagctcaacagcagcttcccgtcagtacactgcagc
tctcggtaccctgacaacaccggctgcagcagccccaggagagccaggccagtctccctc
accgtccccagccagactggagggagcagcaggcagtttcacggcagcgctgggagcctg
gtcgaagcggtcttgatttcggaaggactgatgcagtttgctcaagatccaaagttcatt
gaggtcacaacccaggagcttgcagacgcctgtgacatgacgatagaagagatggaaaat
gcagcagacaacattctcaatggtaacagcaagcagagccccaatggcaacctcttgcct
tttgttaactgcagggacccagggcaggacagtgcaggagaggaagaggaagaggtgcag
aacccggattgtaggataagtcaggaggagctcaaggacagcaggatttatatcagcagc
ctgtag

DBGET integrated database retrieval system