KEGG   Falco peregrinus (peregrine falcon): 101916744Help
Entry
101916744         CDS       T02856                                 

Gene name
GATB, PET112
Definition
(RefSeq) glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00970  Aminoacyl-tRNA biosynthesis
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101916744 (GATB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fpg03029]
    101916744 (GATB)
Enzymes [BR:fpg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     101916744 (GATB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     101916744 (GATB)
Mitochondrial biogenesis [BR:fpg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    101916744 (GATB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 101916744
NCBI-ProteinID: XP_005232603
LinkDB All DBs
Position
Un
AA seq 515 aa AA seqDB search
MEAAHAPQAERSPVKASLAPWVPVVGLEIHAQISSNSKLFSGSQVQFAAPPNSLVSFFDA
SLPGTLPVLNRRCVEAAVMTGLALNCSINKKSLFDRKHYFYADLPAGYQITQQRVPIAVN
GSLSYSLCTGKKMSQMVTKTVRIKQIQLEQDSGKSLHDDTRSQTLVDLNRAGVGLMEVVM
EPDMCCGEEAAAAVRELQLILQTLGSSQAVMAEGQLRVDANVSVHHPGEPYGVKTEVKNI
NSIRFLAKAVDYEIQRQIEELENGGTILNETRAFDSKLGCTVPMRDKEGKQDYRFMPEPN
LPPLIVYDAKSLPANMNHQQVVNIDWIHERLPDLPSVKREKLVEQYGILPEHSFTLLNEE
GLTEFYENVVKQTQMKPKKVIGWILNDLLSYLKQHSLTVKESPVSSFLLADLLNLLEKKD
ISSTAAKQVLAELWKGEGKTPLEIVKEKKLELIQDQKELEQICQAVIDGQENEVMAVKAG
NQKVLNKLIGLVQRETQGRSNPVLVKQLLEKKLSE
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgcacacgcaccacaagctgagcggagcccggtgaaggcgagtcttgctcca
tgggtaccagttgtgggtctggaaattcatgcacagattagctccaactcaaaacttttc
tctggttcccaagtccagtttgcagcacctcctaactctttggtatctttctttgatgct
tctttaccaggaactttaccagttctcaacaggagatgtgtagaagcagcagtgatgaca
ggcctggcactcaactgcagcataaacaagaagtccttgtttgacagaaaacactatttc
tatgcagatctgcctgctggctatcaaatcactcaacaaagagttcccattgcggtgaat
ggaagtctgtcatacagtctctgtacaggcaaaaaaatgagccagatggtgaccaaaact
gtgaggattaaacaaattcagttggagcaagacagtggaaagagtcttcatgatgacaca
aggagtcagactctcgttgacttgaatagggctggagtgggcctcatggaggttgtcatg
gagcctgatatgtgctgtggggaagaagcagctgcagcagtcagagagcttcagctcatt
cttcaaacacttgggagcagccaggcagtcatggcagagggtcagctgagagtggatgcc
aatgtttccgtgcatcaccctggagagccttatggagtgaagaccgaagtgaagaatatc
aatagtatacgattcctggcaaaagcagtagactatgaaatacagaggcaaattgaggaa
cttgaaaatggaggaacaattctgaatgaaacaagagcttttgattccaagcttgggtgc
actgtaccaatgagagacaaagaaggaaaacaggattatcgcttcatgccagagccaaac
cttcctccattgattgtgtacgatgcgaaatctttgccggctaatatgaaccatcagcaa
gtggtaaatattgattggattcatgagaggcttcctgacctccccagtgtgaagagagag
aagcttgttgaacagtatgggattcttcctgaacacagcttcaccttattgaatgaagag
ggattaacagaattctatgaaaatgtggtaaagcagacccaaatgaagccgaagaaggtg
atcggctggattctaaatgacctgctgagttacttgaaacaacattcccttacagtaaag
gaaagcccagttagttcttttctcctggctgaccttttgaaccttctagaaaaaaaagat
atttcttctacagcagcaaagcaggtgcttgcagaattgtggaagggagaagggaagact
cctctggaaattgttaaagaaaagaaacttgaactgatacaggatcaaaaagagcttgaa
cagatctgccaggcagtgattgatggacaagaaaatgaggttatggcggtaaaggcagga
aatcaaaaagtgctaaataaattaattggcctggtacaaagagaaacccaaggacgatcc
aatcctgttctggtgaagcagctattagagaagaagctgtcagagtag

DBGET integrated database retrieval system