KEGG   Falco peregrinus (peregrine falcon): 101917220
Entry
101917220         CDS       T02856                                 

Gene name
SNRPG
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptide G
  KO
K08774  transforming growth factor, alpha
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
fpg04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101917220 (SNRPG)
   04012 ErbB signaling pathway
    101917220 (SNRPG)
SSDB
Motif
Pfam: LSM EGF Adeno_PV CAAD EGF_2
Other DBs
NCBI-GeneID: 101917220
NCBI-ProteinID: XP_013152162
LinkDB
Position
Un
AA seq 184 aa
MRALDHLPRGSPGFCFHGTCRFLVQEDKPACVCHSGYVGTRCEHADLLAVVAANQKKQTI
TALVAVAVVASALLVAACVLVQTLPLHKSTSVLKAPLHFRVAVLVRKRRTRASSPSLSLN
ILGFLVVKLNGGRHVQGILRGFDPFMNLVIDECVEMAPGGQQNNIGMVVIRGNSIIMLEA
LERV
NT seq 555 nt   +upstreamnt  +downstreamnt
atgcgggcgctggaccacctcccgcgcggcagccccggcttctgcttccacggcacctgc
cggttcctggtgcaggaggacaagccggcgtgcgtgtgccactcggggtacgtggggacg
cggtgcgagcacgccgacctgctggccgtggtggccgccaaccagaagaagcaaaccatc
accgccttggtggcggtggcggtggtggcctcggcgctgctggtggcggcgtgcgtcctg
gtgcaaacgcttccacttcacaaaagcacgtccgtcctcaaggccccgctccatttcaga
gtggcagttctggtgaggaagcgtcggacgcgcgcgtccagcccttccctttctttaaac
atcctcgggtttcttgtagtgaaattgaatggcggcagacacgtccaggggattttgcgg
gggtttgatcccttcatgaacctcgtcatcgatgagtgcgtggagatggcgccgggaggg
caacagaacaacatcggcatggtggtaatacgagggaacagcatcatcatgctggaagcc
ttggaacgagtatag

DBGET integrated database retrieval system