KEGG   Falco peregrinus (peregrine falcon): 101917601Help
Entry
101917601         CDS       T02856                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00010  Glycolysis / Gluconeogenesis
fpg00053  Ascorbate and aldarate metabolism
fpg00071  Fatty acid degradation
fpg00260  Glycine, serine and threonine metabolism
fpg00280  Valine, leucine and isoleucine degradation
fpg00310  Lysine degradation
fpg00330  Arginine and proline metabolism
fpg00340  Histidine metabolism
fpg00380  Tryptophan metabolism
fpg00410  beta-Alanine metabolism
fpg00561  Glycerolipid metabolism
fpg00620  Pyruvate metabolism
fpg01100  Metabolic pathways
Module
fpg_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
fpg_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101917601 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    101917601 (ALDH7A1)
   00620 Pyruvate metabolism
    101917601 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101917601 (ALDH7A1)
   00561 Glycerolipid metabolism
    101917601 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101917601 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    101917601 (ALDH7A1)
   00310 Lysine degradation
    101917601 (ALDH7A1)
   00330 Arginine and proline metabolism
    101917601 (ALDH7A1)
   00340 Histidine metabolism
    101917601 (ALDH7A1)
   00380 Tryptophan metabolism
    101917601 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101917601 (ALDH7A1)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101917601 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     101917601 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     101917601 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-GeneID: 101917601
NCBI-ProteinID: XP_005242593
LinkDB All DBs
Position
Un
AA seq 480 aa AA seqDB search
MVSKEGKKACTAVLLMVFVLRVEANLEDYEETVKKAKEAWKVWADIPAPKRGEIVRQIGD
ALRQKIKVLGSLVSLEMGKIFVEGVGEVQEYVDVCDYAVGLSRMIGGPILPSERPGHALI
EQWNPVGLVGIITAFNFPVAVYGWNSAIAMICGNACLWKGAPTTSLISVAVTKIIAKVLE
DNKVPGAICSLVCGGADIGTAMARDERMDLLSFTGSTKVGKQVALMVQERFGRSLLELGG
NNAIIVFEDADLNLVIPSALFAAVGTAGQRCTTARRLFLHESIHDEVVTKLAKAYAQVRI
GDPWDSDTLYGPLHTKEAVKMFLDAVEQAKQQGGSVVYGGKVINRPGNYVEPTIVTGLPH
NAPIVHTETFAPILYVLKFKEEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCG
IVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKLYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcaaaggaggggaagaaagcctgtacggctgttcttttgatggtgtttgttctc
cgggtagaggctaatttggaggattatgaagaaacagtaaagaaggctaaagaggcatgg
aaggtctgggctgatatccctgcacctaagcgtggagaaatagtgcgacagattggtgat
gccctgagacaaaaaattaaagttctaggaagcttggtctctttggaaatgggaaagatt
tttgtcgagggtgttggggaagtgcaggagtatgttgatgtctgtgactatgctgttggt
ttgtcccgaatgattggtggtcctattttgccttcagaaagacccggccatgcccttata
gagcagtggaatcctgttggtttagtgggaatcatcacagcttttaacttccctgtagct
gtttatgggtggaacagtgcaattgccatgatctgtggaaatgcttgcctctggaagggt
gctcctacaacatccctcattagtgttgctgttacaaagataattgccaaagtcttggag
gataacaaagttccaggagcaatctgttctctggtttgtggtggagcagacattggaaca
gcaatggcgagagatgagagaatggacctgttgtccttcactggcagcacgaaagtcggc
aagcaagtagcgcttatggttcaggagagatttggtcgaagtctgctggaactgggagga
aacaatgccattattgtgttcgaagacgcagatctgaacctagtcatcccatctgctctg
tttgcggctgtgggaacagcgggtcagagatgcacaactgctagaaggctgttcctccat
gaaagcatccatgatgaggtggtgacaaagcttgcgaaggcctatgcccaggtccgcatc
ggtgatccatgggattctgacactctgtatgggcctcttcataccaaagaagcagtgaaa
atgtttcttgatgcagtagaacaagcgaaacaacagggtggctctgtggtctacggtgga
aaggttataaatcgccctggaaactatgttgaaccaaccattgtgactggccttcctcat
aatgcacccattgtccacactgagacatttgcccccatactgtatgtgctgaaatttaag
gaggaagaggaggtgtttgcctggaataatgaagtaaaacaaggtctttccagcagcatc
tttaccaaggatttgggaaggattttccgctggcttggaccgaaggggtctgactgtggc
attgtgaatgtcaacatcccaaccagtggggctgagattggaggcgcttttggtggtgaa
aagcacactggtgggggaagagaatctggaagtgattcatggaaactttatatgagacgg
tctacttgtacaatcaactacagcaaggatttacctttggctcaaggaatcaagtttcag
taa

DBGET integrated database retrieval system