KEGG   Falco peregrinus (peregrine falcon): 101917962Help
Entry
101917962         CDS       T02856                                 

Gene name
AOC1
Definition
(RefSeq) amine oxidase, copper containing 1
  KO
K11182  diamine oxidase [EC:1.4.3.22]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00330  Arginine and proline metabolism
fpg00340  Histidine metabolism
fpg00380  Tryptophan metabolism
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    101917962 (AOC1)
   00340 Histidine metabolism
    101917962 (AOC1)
   00380 Tryptophan metabolism
    101917962 (AOC1)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.22  diamine oxidase
     101917962 (AOC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 Cu_amine_oxidN3 DUF1965
Motif
Other DBs
NCBI-GeneID: 101917962
NCBI-ProteinID: XP_005229648
LinkDB All DBs
Position
Un
AA seq 703 aa AA seqDB search
MWLLRLAWALAVLGIAAGSGPGPTVPPPDKASIFADLSPAELRAVRTFLMSRPELGLSPS
RGAPLAKNTLFLVELLPPKKRLALRYLDQGGPRPRRQARAVIFFGGQAEPNVTEFAVGPL
PQPSSYQPLRFKGGCAVPFAARPMTQLEYELLHRTLAEAMEPLYRLLRDSTGFWYHNCSQ
RCLTFSDIAPRGLAPGERRSWLVLQRFVEGFFLHPVGLEVLVDHGDPDPRRWAVQRLWYN
GQYFSSAQELAERYERGTLAVAYLAEPPLRQLFSSYEPRGHFATGTPTEVHGAKVCEPQG
RRYRLQGNQLEAAMQTKYRDAGWGMGSVTYELARGIDCPETATYLDAHHLYDTDGPVRFS
HAICIFELPTGVPLRRHFDSDFQGGFHFYAGLEGHALVLRTTSTVYNYDYIWDFLLYPNG
VMEAKVHATGFIHATFYTPQGRRYGSRVHSHVLGNLHTHLVHYKVDLDIAGTSNSFETMD
VRFENISNPWSPGARVVQPWLHRQPRRSERQAAFPFGKALPRYLLFYNPHQHNRWGHPRS
YRIQHSSHAGRVLPRGWQEEKGVSWGRYHLAVTRHHENEPSSSSIYAQNNPWEPLVSFEG
FIHNNETIEDQDLVAWVTVGFLHVPHAEDIPNTATPGNAVGFFLRPFNFFDEDPSVASRS
PVIVRPLDSPTFSRLEIQRWTPASPGPCVAPEPFTYNGTYRQE
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgctccggctcgcctgggcactggctgtgctgggcattgcggctggctctggc
cctggccccactgtgccgcctccggacaaggcatccatcttcgctgacctgtctccagca
gagctgagggccgttcggaccttcctgatgagccgcccagagctggggttgtccccgagc
cggggggcgcccctggccaagaacaccctcttcttggtggagctgctgccccccaagaag
cggctggccctgcgctacctggaccagggcggcccccggccccggcgccaggctcgggca
gtcatcttctttggggggcaggcagagcccaatgtcaccgaattcgctgtggggcccctg
ccgcaacccagctcctaccagccgctgcgcttcaaggggggctgcgccgtgccctttgct
gcccggcccatgacccaactggagtatgagctgctgcaccgcacactggcagaggcgatg
gagccactctaccggctgctgcgcgactccaccggcttctggtaccacaactgctcccag
cgctgcctgaccttctcggacatcgcgccgcgggggctggcacccggcgagcggcgcagc
tggctggtgctgcagcgctttgtggagggcttcttcctgcacccggtggggctggaggtg
ctggtggaccatggggaccccgacccgcgccgctgggcagtgcagcggctctggtacaat
gggcagtacttctccagcgcgcaggagctggccgagcgctatgagcgggggacactggcg
gtggcctacctggctgagcccccgctccggcagcttttctccagctatgagccccgtggg
cacttcgccactggcacccccaccgaggtgcacggggccaaggtgtgcgagccccagggc
cggcggtaccggctgcagggcaaccagctggaggccgccatgcagaccaagtacagggat
gctggctggggcatgggctctgtcacctatgagctggcccgcggcatcgactgccccgag
acagccacctacctggatgcccaccacctctacgacaccgacgggccagtgcgcttctcc
catgccatctgcatcttcgagctgcccaccggtgtcccgctccgccgccactttgacagc
gacttccagggggggttccacttctatgccggcctggaggggcacgcgctggtcctgcgc
accacctccactgtctacaactatgactacatctgggacttcctcctctaccccaacggc
gtgatggaggccaaagtccatgccactggcttcatccatgccaccttctacacaccacag
ggacggcgctacggcagccgtgtccacagtcacgtcttgggcaacctccacacccacctg
gtgcactacaaggtggacctggacatcgcaggcaccagcaacagcttcgagacgatggat
gtgcgcttcgagaacatctccaacccctggagcccgggcgcccgcgtggtgcagccttgg
ctgcaccggcagccccgtcgcagcgagcgccaggctgccttcccctttggcaaggcgctg
ccacgctatctgctcttctacaacccgcaccagcacaaccgctggggccacccacgcagc
taccgcatccagcacagctcccatgccgggcgggtgctgccacgtggctggcaggaggag
aagggcgtctcctggggcaggtatcacctggctgtgacgcggcaccacgagaatgagccc
agcagcagcagcatctacgcccagaacaacccctgggagcccctggtcagcttcgagggc
ttcatccacaacaacgagaccatcgaggaccaggacttggtggcctgggtgaccgttggc
ttcctgcatgtccctcacgctgaggacatccccaacacagccacccctggcaatgctgtc
ggcttcttcctgcgccccttcaatttcttcgacgaggacccctcggtggcctcgcgcagc
cctgtcatcgtccggccactggactcccccaccttctcccggctggagatccagcgctgg
acacctgccagccccggcccctgcgtcgccccggagcctttcacctacaatggcacctac
cggcaggagtga

DBGET integrated database retrieval system