KEGG   Falco peregrinus (peregrine falcon): 101917971
Entry
101917971         CDS       T02856                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04068  FoxO signaling pathway
fpg04217  Necroptosis
fpg04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101917971 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101917971 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101917971 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fpg03000]
    101917971 (STAT3)
Transcription factors [BR:fpg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101917971 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR Fib_alpha Tropomyosin_1
Other DBs
NCBI-GeneID: 101917971
NCBI-ProteinID: XP_005232769
LinkDB
Position
Un
AA seq 779 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
AAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLXXXXXXXXXXXSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAE
IIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGSAAPYLKTKFI
CVTPTSFSNTIDLPMSPRTLDSLMQFGNNSEGAEANAGGQFESLTFDMELTPECASSPM
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacgcggtacctggagcagctccaccag
ctctacagcgacagctttcccatggagctccggcagttcctggccccgtggattgagagc
caggactgggcgtacgctgccagcaaggagtcgcatgccacgctggtgttccacaacctg
ctaggggagatcgaccagcagtacagccgcttcctgcaggagtccaacgtcttgtaccag
cacaacctgcggcgcatcaagcagttcctgcagagcagatacttggagaagccgatggaa
atagcccgcatcgtggcccgctgcctgtgggaagagtcccggctcctccagacggctgct
gcagcggcccagcaagggggacaggcaacacatcccacggcggcggtagtgaccgaaaag
cagcagatgctggagcagcatctgcaggatgtgaggaagagggtgcaggatctggagcag
aagatgaaagtggtggagaatctccaggatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggatctgaatggaaacaatcagtccgtgacccggcagaaaatg
cagcagctggaacagatgctcacggcgctggaccaaatgcgaaggggtattgtgagcgag
ctggctgggctgctgtcagccatggagtacgtgcagaagatgctggcagatgaggaattg
gcagactggaagaggcggcagcagatcgcctgcattggcggcccaccgaatatctgttta
gaccggcttgagaactggataacctctcttgccgaatcacagctacaaacccggcagcag
atcaagaagttggaagaactgcagcaaaaagtgtcttacaagggtgacccaattgtccaa
caccggcccatgctggaggagcggattgtggagctcttcaggaacctgatgaaaagtgct
tttgtcgtggagaggcagccctgcatgcccatgcaccccgaccggcccctggtcatcaaa
actggggtgcagttcaccaccaaagtcaggttgttggtcaagtttccagagctgaactat
cagctgaaaattaaagtctgcattgacaaggactccggggatgttgcagcacttcggggg
tcgcggaagtttaacatcctggggacaaacaccaaagtcatgaacatggaggagtcgaac
aacggcagcctctcagcagagttcaagcacctgaccctgcgggagcagcggtgtggtaat
ggaggcagagccaactgcgatgcctcgctgatcgtcaccgaggagctgcacctcatcacc
tttgagacagaggtgtatcaccagggtctgaagatcgacctggagacccactcgctgcct
gtggtggtcatctccaacatctgccagatgcccaatgcctgggcgtccatcctgtggtac
aacatgctgaccaacaaccccaagaatgtgaacttcttcaccaagcctcccatcgggacc
tgggaccaggtggcagaggtgctgagctggcagttctcctccaccacaaagcgcggcctc
agcatcgagcagctgacgacgttggcagaaaaacttctagggccaggtgtgaattactct
ggctgtcagatcacctgggccaagttctgcaaggagaacatggctggcaaaggcttctct
ttctgggtctggctggacaacatcattgacttggtgaaaaagtacatcctggcgctgtgg
aacgaagggtacatcatggggttcatcagcaaggagcgggaacgagccatcctgagcacc
aagcccccgggaaccttcctgnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntcagcgag
agcagcaaggaaggcggcatcaccttcacatgggtggagaaggacatcagtgggaagacc
cagatccagtctgtggagccttacaccaagcagcagctgaacaacatgtcgtttgcggag
atcatcatgggctacaaaatcatggatgccaccaacatcctggtgtcccccctggtgtac
ctgtacccagacatccccaaggaggaggcgtttgggaagtactgccgctctgagagccag
gagcactctgaagctactgactcaggtagtgctgctccgtatctgaagaccaaattcatc
tgcgtcacccccacctccttcagcaacaccatcgacctgcccatgtccccgcgcaccctg
gactcgctcatgcagttcggcaacaacagcgagggagcagaggccaacgcgggggggcag
ttcgagtcgctgaccttcgacatggagctgaccccggagtgtgcgtcttcacccatgtga

DBGET integrated database retrieval system