KEGG   Falco peregrinus (peregrine falcon): 101918053Help
Entry
101918053         CDS       T02856                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101918053 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fpg03036]
    101918053 (HDAC4)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101918053 (HDAC4)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101918053 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 101918053
NCBI-ProteinID: XP_005241345
LinkDB All DBs
Position
Un
AA seq 1080 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPPRVNHMPSSVDVTTALPLQVAPTSVPMDLRLDHQFSMP
VTEPTLREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQEMLAM
KHQQELLEHQRKLEQHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLN
KKKALAHRNLNHCISSDPRFWYGKTQHSSLDQSSPPQSGVSGTYNHPVLGMYDSKDDFPL
RKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACNSAPGSGPS
SPNNSSNNISAENGIAGSVTSIQAETSLAHRLVNREGSVTQLPLYTSPSLPNITLGLPAT
GPSSGGSAQQDAERLTIPTLQQRISLFPGTHLTPYLSTTTLERDGGTAHNPLLQHMVLLE
QPTAQTPLVTGLPLHAQSLVGGERVSPSIHKLRQHRPLGRTQSAPLPQNAQALQQLVIQQ
QHQQFLEKHKQQFQQQQLHINKIISKPNEPARQHESHPEETEEELREHQALLEEPYSDRV
TSQKEAPGLANMVQVKQEPIESDEEEAEPQQELESGQRQAEQELLFRQQALLLEQQRIHQ
LRNYQASLEAAGMPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLMLK
HQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYG
TNPLNRQKLDSKKLLGSLTSMFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVIELVFK
VATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHHG
NGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGAGVGFNVNMAFTGGLDPPMGD
TEYLTAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLA
GGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVFQQRANANAVHSMEKVIEIH
SKYWHSLQRYASTVGYSLVEAQKCENEEAETVTAMASLSVGVKPAEKRPDDEPMEEEPPL
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatgggctttctggcagagaccagccagtagagctgttg
aatccacctagagtgaaccacatgcctagctctgttgatgtgaccacagcactgcccttg
caagttgcaccgacttcagtcccaatggatctgcgcttggaccaccagttttccatgcct
gtgacggagccgacactgcgggagcagcaactgcagcaggagctcctggcactgaagcaa
aaacagcagatccagagacagatcctcatcgctgagttccagcggcagcacgagcagctc
tcccggcagcacgaggcccagctgcatgagcacatcaaacagcaggagatgctggcaatg
aagcatcagcaggagctgttggagcaccagaggaagttggagcagcaccgacaggagcag
gagctggagaagcagcaccgagagcagaaacttcagcagctaaaaaacaaagagaaagga
aaagagagtgcagtggcaagcacagaagtaaagatgaaattacaagaatttgtcttaaat
aagaagaaggcattggcacaccggaatctcaaccactgcatatccagtgatcctcgcttc
tggtatgggaagacacagcacagctctctggaccagagctccccaccccaaagtggcgta
tccggcacctacaatcaccctgtactggggatgtatgattccaaagatgacttcccactc
agaaaaacagcatctgaacccaacctgaagttacgatccagactaaagcaaaaagttgct
gaaagacggagcagccccctcttgcgcagaaaagatggtccggtggttactgctctcaag
aagcgcccgctggatgtcacagactctgcatgcaacagtgctcctggatctggtcccagc
tctccaaacaacagctccaataacataagcgctgagaacggaattgcaggatcagtcacg
agtattcaagcagagaccagcctggctcacagacttgtgaatcgtgaaggctcagtaaca
cagcttccactctacacgtctccttctttgcccaacatcacgctaggactgcctgcaact
ggcccttccagtggaggatcagcacagcaggatgcggagagacttactatcccaacgtta
cagcagcggatctctttatttcctggcactcacctcactccctacttgagcactacaacg
ttggaaagagatgggggaactgcacataaccctcttttgcaacacatggtcttactggaa
cagccaactgcacaaactcccttagtcacaggactgcctctccacgcacagtctctggtt
ggtggagaacgggtctccccttcaatacacaaactccggcagcatcgcccgctggggcgc
acgcagtctgctccccttccgcagaacgcccaggccctccagcagttagtgatccagcag
cagcaccagcagttcttggagaaacacaaacagcaattccagcaacaacaactgcacatc
aacaagattatatcaaaacccaacgaaccagctcgccagcatgaaagccaccctgaggag
acagaagaagagttacgagaacaccaagcccttttggaggagccatacagcgacagagtc
acaagccagaaggaagccccggggctggccaatatggtccaagtgaagcaagaacccatt
gagagtgatgaggaggaggcagagccacagcaggagctggagtctgggcagaggcaggct
gagcaggagctgcttttccgtcagcaagcccttctgttggagcagcaacgtattcaccag
ctgagaaactaccaggcgtcgctggaggcagctggcatgcccgtctcttttggagggcat
cggcctctgtcccgtgcacagtcctcacccgcctcagccaccttcccgatgtctgtacag
gagccacccactaagccaaggttcaccacaggccttgtatatgacactttgatgctgaaa
caccagtgtacctgtggaaacacaaacagccacccagagcacgcggggaggatccagagc
atctggtcccggctccaggagacgggtctccgtggcaagtgtgagtgcattcgtggaaga
aaagcaactctagaagagctgcagacagttcactcggaagcccatacgctgctgtatggc
acaaaccctctgaacagacagaaactggacagcaagaaacttctaggttctttaacgtcg
atgtttgtcaggcttccttgtggtggtgtcggggtcgacagtgacacaatttggaacgaa
gttcactcgtctggtgccgctcgcctggctgtgggctgtgtcattgagctcgttttcaaa
gtagccacaggagaactgaagaatggatttgctgttgttcggcctccgggtcaccacgca
gaagagagcacacccatgggtttctgctatttcaactccgtggcaattgcagccaagctg
ctccagcaaaggctgaacgttagcaaaatccttatagtggactgggatgttcaccacggg
aatggtactcagcaagctttctacaatgatcctaatgttctttatatttcactacatcgc
tatgatgatgggaacttctttccaggcagcggtgctcctgacgaggttggcacaggagca
ggagttggtttcaatgttaacatggcctttactggtggccttgatccaccgatgggagat
acagaatacttaactgctttcagaacggtagtaatgcccattgccaatgaatttgcccca
gatgttgtgctggtgtcatctggtttcgatgcggtggaaggccatcccacaccccttgga
ggatataatctatcagcaaaatgcttcgggtacctgacgaagcagctgatgggcctggct
gggggtcgcgtcgtcctggcccttgaaggaggccatgacctgactgccatttgcgatgcc
tcggaagcgtgtgtttctgctttgctgggaaacgagcttgatcctcttccagaaaaggtt
ttccagcagcgagcaaacgctaatgcggtgcattcaatggagaaagtgattgagatacac
agcaagtactggcattcactccagcgttacgcttccacggtgggatactccctggttgag
gctcagaagtgcgagaacgaggaggcagagactgtaacagccatggcatctctgtcagtg
ggcgtgaagccagctgagaagagacctgatgatgaacccatggaagaggaacctcccctg
tag

DBGET integrated database retrieval system