KEGG   Falco peregrinus (peregrine falcon): 101918224Help
Entry
101918224         CDS       T02856                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00500  Starch and sucrose metabolism
fpg01100  Metabolic pathways
fpg04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101918224 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101918224 (GYS2)
Enzymes [BR:fpg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101918224 (GYS2)
Glycosyltransferases [BR:fpg01003]
 Polysaccharide
  Storage polysaccharide
   101918224 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_trans_1_4 Glycos_transf_1
Motif
Other DBs
NCBI-GeneID: 101918224
NCBI-ProteinID: XP_005240168
LinkDB All DBs
Position
Un
AA seq 702 aa AA seqDB search
MPLARSLSMNSLNGLPQWEDEDLPVEHLLLFEVSWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLVGPYFEHNVKTQVEACEPPHLAVKKAMDTMKSQGYQVYFGRWLIEGSPYVLLFDI
GAAAWNLDRWKGEFWDVSNIGIPFHDQEANDAVIFGSLTAWFLKELSCQFADKPNVIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITAVEAEHMLKRNPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFSLEKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKTD
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGKKLYNALLKGEIPDLNKI
LDRDDMTIMKRAIFSTQRHCLPPVTTHNMIDDGNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRTFPDKFEMEPSAPPKTEGFRYPRPSSVPPSPSVSQHSSPHHSED
EDEDERYDEDEEAERDRQNIKSPFSLGVLPQGKKKQHGEYRN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgccactggctagatcactgtccatgaattctcttaatgggcttcctcagtgggaggat
gaagacctaccagtggagcacttgttgctctttgaagtttcttgggaagttaccaacaaa
gtgggaggcatttacactgtgatccagacaaaagctaaaactacagcagatgaatggggt
gaaaactattttctggttggtccctattttgagcacaatgtgaagactcaggtggaagca
tgtgagcctccacacctggcagttaagaaggcaatggacaccatgaaaagccaagggtat
caggtctattttggaagatggctgatagagggcagcccatatgtcttactgttcgatata
ggagcagcagcttggaatctggacaggtggaaaggtgaattttgggatgtcagcaacata
gggatcccttttcatgaccaagaagccaatgatgctgtgatatttggatcgttaacagcc
tggtttttaaaagagctttcctgtcagtttgctgacaaacccaatgtaattgcccacttc
catgagtggcaggcaggagtgggtttaatactgtctcgatctcagaaacttcctgttgcc
acaatttttactacccatgcaactctgcttgggagatacctgtgtgcagccagtatagat
ttttacaacaatcttgaccagtttgacattgacaaggaagcaggagagagacagatttac
catcggtactgtatggaacgggcctctgtacattgtgcccatgtgttcaccacagtctca
cagataacagctgtggaagcagaacatatgcttaaaagaaatcctgatgttgtcacccca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcagt
cttgagaagaccttatttttcttcattgctgggagatacgaattttccaacaaaggagct
gatatgtttctagaagccttatcaagattaaactttttgctgagggttcataagactgat
gttacagttgtcgtgttcttcatcatgccagcaaagacaaacaatttcaatgtggaaacc
ctgaaaggacaagcggtgcggaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaaagaaactctacaatgccctgctaaaaggagaaattccagacctgaacaagatt
cttgaccgagatgatatgaccattatgaaaagagccatcttttcaactcagcgacactgt
ctgcccccagtgaccacccacaacatgattgacgatggcaatgatccaatcctcaacacc
atccgacgcattggccttttcaataaccggacagacagagtaaaggtgatcctacatcca
gagtttctttcttcaacaagcccgttgctgcccttggactatgaggattttgttagaggc
tgccaccttggtgtatttccatcgtactacgaaccctggggttacactccagctgaatgt
actgtgatgggcattcccagtgtaaccacaaacctttctggattcggctgtttcatgcag
gaacatgttgctgacccagcggcttatggcatctacatagttgacagaaggttccgctca
cctgatgaatcatgcaaccagctgactcagttcctgtatgggttttgtcagcagtcccgt
cgccagaggatcatccaaagaaaccgaactgagaggctctcagatctgttggactggaga
tacttaggcaggtattacatgcatgccagacacttggccctcagcagaacattcccagat
aaatttgagatggaaccaagtgctccaccaaagacggaaggtttcaggtaccccaggcct
tcatcggtgccaccatcaccttctgtctctcaacattccagccctcaccacagtgaagat
gaagatgaggatgaaagatatgatgaggatgaggaagctgaaagggataggcaaaacata
aagtctcccttttctcttggagtattgccacaaggaaaaaagaagcagcatggagaatac
aggaactga

DBGET integrated database retrieval system