KEGG   Falco peregrinus (peregrine falcon): 101918488
Entry
101918488         CDS       T02856                                 

Gene name
SMURF1
Definition
(RefSeq) SMAD specific E3 ubiquitin protein ligase 1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04120  Ubiquitin mediated proteolysis
fpg04144  Endocytosis
fpg04340  Hedgehog signaling pathway
fpg04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101918488 (SMURF1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101918488 (SMURF1)
   04350 TGF-beta signaling pathway
    101918488 (SMURF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101918488 (SMURF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fpg04131]
    101918488 (SMURF1)
   04121 Ubiquitin system [BR:fpg04121]
    101918488 (SMURF1)
   03029 Mitochondrial biogenesis [BR:fpg03029]
    101918488 (SMURF1)
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     101918488 (SMURF1)
Membrane trafficking [BR:fpg04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101918488 (SMURF1)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101918488 (SMURF1)
Ubiquitin system [BR:fpg04121]
 Ubiquitin ligases (E3)
  HECT type E3
   101918488 (SMURF1)
Mitochondrial biogenesis [BR:fpg03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    101918488 (SMURF1)
SSDB
Motif
Pfam: HECT WW HPS3_N
Other DBs
NCBI-GeneID: 101918488
NCBI-ProteinID: XP_013151510
LinkDB
Position
Un
AA seq 557 aa
MEEPAPYTDTTGAAGGGNCRFVESPSQDQRLQAQRLRTPEVRGHVQTPQNRPHGHQSPDL
PEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELGPLPPGWEVRSTVSGRI
YFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQQPLPAPNEGSLEDGEELPAQRYERDLVQ
KLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDY
GGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAV
FHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHN
AFGRILQHELKPNGRNIPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLL
KPFDQKELELIIGGLDKIDLNDWKSNTRLKHCMADSNIVKWFWQAVETFDEERRARLLQF
VTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKL
YEKLLTAVEETCGFAVE
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggaagaaccagcaccatatacagacactacgggggctgctggcggaggtaactgtcgc
tttgtagagtcccccagtcaagatcagaggcttcaggcacagcgacttcggactcctgaa
gtcagaggtcatgtacagacacctcagaacagaccgcacggtcaccagtcgcctgaccta
ccagaaggctacgaacaaagaacaacggtacagggacaggtttattttttgcacacacag
actggagttagcacatggcacgaccctaggataccaagagaccttaacagtgtgaattgt
gatgaactaggacctttgcctccaggttgggaagttagaagtacagtttcaggaaggata
tattttgtagatcataacaacagaaccacacaattcacagatccacgactacatcacatc
atgaaccatcaatgccagctaaaagagccgagccagcagcctctgccagctccaaatgag
ggatcactagaagacggtgaggagttgcctgcacagagatatgaaagagacttggtacaa
aagttgaaagttcttagacacgagctctctcttcagcaacctcaggctggtcactgtcgc
attgaagtgtccagagaggaaatatttgaggaatcctaccgtcagataatgaagatgaga
ccaaaggacttgaaaaagaggcttatggtgaaatttcgaggagaagaaggcctggattat
ggaggagtagcaagagaatggttgtatttactgtgccatgaaatgctgaatccttattat
ggactcttccagtactctacagataatatttacatgctgcaaatcaatccagactcttct
atcaatcctgaccatttgtcttatttccattttgtgggtcggataatgggtttggctgtg
ttccatggacactatatcaatggggggttcacggttccattttacaaacagcttctgggg
aagcccattcagctctccgatctggaatctgttgacccagaattacacaaaagtttagtc
tggatcttagagaatgatatcaccccagttctggaccatacattttgtgtggaacacaat
gcttttgggcggattttacagcacgagctcaaaccaaatggcaggaatattccagtgaca
gaagagaacaagaaagaatatgtcaggttgtatgtaaactggcgttttatgagaggaata
gaggcacagttcctggctctgcagaagggttttaatgaacttattcctcaacatctcctt
aagccttttgaccagaaggaacttgagctaatcataggaggcctggataagatagacctg
aatgactggaagtcaaacacgcgtctaaagcactgcatggcagatagcaatattgtgaag
tggttctggcaagcggtggaaacatttgatgaagaaagaagggcaaggctgctgcagttt
gtgacgggttcgacacgtgtcccgcttcaaggtttcaaggctttacaaggttctacaggc
gctgcaggacccagactgtttaccatccatttaatagatgcaaacacagacaaccttcca
aaagcccacacttgctttaaccggattgacattccgccttatgagtcatacgagaagctt
tatgagaagctgttgacagctgtggaagagacatgtgggtttgctgtggagtga

KEGG   Falco peregrinus (peregrine falcon): 101924223
Entry
101924223         CDS       T02856                                 

Gene name
SMURF2
Definition
(RefSeq) SMAD specific E3 ubiquitin protein ligase 2
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04120  Ubiquitin mediated proteolysis
fpg04144  Endocytosis
fpg04340  Hedgehog signaling pathway
fpg04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101924223 (SMURF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101924223 (SMURF2)
   04350 TGF-beta signaling pathway
    101924223 (SMURF2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101924223 (SMURF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fpg04131]
    101924223 (SMURF2)
   04121 Ubiquitin system [BR:fpg04121]
    101924223 (SMURF2)
   03029 Mitochondrial biogenesis [BR:fpg03029]
    101924223 (SMURF2)
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     101924223 (SMURF2)
Membrane trafficking [BR:fpg04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101924223 (SMURF2)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101924223 (SMURF2)
Ubiquitin system [BR:fpg04121]
 Ubiquitin ligases (E3)
  HECT type E3
   101924223 (SMURF2)
Mitochondrial biogenesis [BR:fpg03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    101924223 (SMURF2)
SSDB
Motif
Pfam: HECT WW HPS3_N
Other DBs
NCBI-GeneID: 101924223
NCBI-ProteinID: XP_013154689
LinkDB
Position
Un
AA seq 642 aa
MSPYSLQNEAVHKFWSSRRQRGVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASG
RIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENTPITGTNGATCGQSSDPRLAER
RVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNI
NCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQHQQ
QQQVVSLCQLPDEAECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEES
YRQVMKMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYT
LQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLDDMELVD
PDLHNSLVWILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVTEENKKEYVRLYV
NWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKANTRLKHC
TPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDAS
TNNLPKAHTCFNRIDIPPYESYDKLYEKLLTAIEETCGFAVE
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgagtccttactcattacaaaatgaagccgtgcacaaattttggtcctcacgtaggcaa
agaggagtaagtcttcagtccagagaccgaataggcacaggaggacaagttgtggattgc
agtcggttatttgataatgatttaccagatgggtgggaggagcggagaactgcttctgga
aggatccagtatttaaatcacattacacgaacaactcagtgggagcgaccaacacggccg
gcatctgaatactccagcccaggcagaccgctcagctgttttgtggacgagaacactccg
attacagggacgaacggtgcaacctgtgggcagtcatcagatccccggctggcggagagg
agagtcaggtcacagaggcacagaaattacatgagcaggacacacttgcacactcctccc
gatttacccgaaggatatgagcaaaggacgactcagcaaggtcaggtctattttctgcat
actcagactggtgttagcacgtggcacgatccaagagtacctagggatcttagcaacatc
aattgtgaagagcttggtccactgcctcctggatgggagatccgaaatacggcaacaggc
agagtttattttgttgaccataacaacaggacaacgcagtttacagatccacggctatct
gctaacttgcatttagttttaaaccgccagaatcaacttaaagatcagcagcaccagcag
cagcagcaggtagtgtccctgtgtcagctgccagatgaggcagagtgtctgactgtgcca
aggtacaagcgagacctagtgcagaaactcaagatcctgaggcaagagctgtcacagcag
caacctcaagctggccattgtcgtattgaggtctccagggaagagatttttgaggaatcc
tacaggcaagtcatgaagatgaggccaaaagacctgtggaaacgattaatgataaaattt
cgtggggaggaaggcctcgattatggaggtgttgccagggaatggctctacctgttgtca
cacgaaatgttgaatccgtattatggtctcttccaatattcccgagatgatatctataca
ctgcaaatcaaccccgactctgcagtcaacccggaacacttatcatatttccactttgtt
ggacggatcatggggatggctgtgtttcacggacactatattgatgggggcttcacgctg
cctttctataagcagttgctagggaagccaattactttggacgatatggaattggttgac
cctgatcttcataacagcttagtctggatacttgagaatgatatcacaggagtcttggac
catacgttttgtgtagaacacaatgcatacggggaaattattcaacatgaactgaaaccc
aacggcaaaagcatccctgtgacagaggaaaacaaaaaggaatatgtcagactttatgta
aactggcgatttttacgaggaattgaagctcagtttctggctctacagaagggatttaat
gaagtaatcccacaacatctgctgaagacatttgatgagaaagagttagagctgatcatt
tgtggactgggaaaaattgatgtcaatgactggaaggcaaacactaggttaaaacactgt
accccagacagcaacattgtgaaatggttctggaaagctgtggagttttttgatgaagag
aggagagcgcgactgctccagttcgtgaccggctcatcccgagtgcctctgcagggcttc
aaggcattgcaaggtgctgcaggcccacggctatttacaatacaccagattgatgccagc
actaataatttgccgaaagctcatacctgctttaaccgaatagacattcctccttacgag
agctacgacaagctatacgagaagctgctaactgccattgaagaaacgtgcgggtttgcc
gtggaatga

DBGET integrated database retrieval system