KEGG   Falco peregrinus (peregrine falcon): 101918651Help
Entry
101918651         CDS       T02856                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00052  Galactose metabolism
fpg00500  Starch and sucrose metabolism
fpg01100  Metabolic pathways
fpg04142  Lysosome
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101918651 (GAA)
   00500 Starch and sucrose metabolism
    101918651 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101918651 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpg04147]
    101918651 (GAA)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101918651 (GAA)
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101918651 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101918651
NCBI-ProteinID: XP_005244045
LinkDB All DBs
Position
Un
AA seq 792 aa AA seqDB search
MYRYTHTLRYTCAHRYTRTHRPAARVRRWQRARPGAGVSLRYPARPRYEVPLAAPRVGGR
AATTLYGVQVNQDPFGLVVYRQHGGQVLVNTTVAPLFFADQFLQISTSLPSHFISGLGEH
LTPLVLDTAWTRVTLWNRDMAPTAQVNLYGSHPFYLGMEDGGLAHGVFLLNSNAMDVLLQ
PSPALTWRTTGGILDFYVFLGPDPKSVVRQYLDVVGFPFMPPYWGLGFHLCRWGYSSTDI
TRQVVDNMTAARFPLDVQWNDMDYMDAKRDFTFNKKSFKDYPEMVRDFHRRGLRYIMIVD
PGISSSGPPGTYKPYDEGLKRGVFIQNATGQPLIGKVWPGPTAFPDFTNPETHEWWHDMV
KDFHNQVPFDGMWIDMNEPSNFVEGSQDGCPNNSLEQPPYVPGVFGGRLQAGTICASSQQ
YLSSHYNLHSLYGLTEAIASHDALLRVRGKRPFVISRSTFAGHGHYAGHWTGDVSSNWEQ
LYYSIPEVLLFNLFGVPLVGADICGFVGNTSEELCVRWTQLGAFYPFMRNHNDHGTRPQE
PYTFSPAAQAAMRNALRLRYSLLPFLYTRFHRAHSAGETVARPLFLEFPKDPNTWAVDRQ
LMWGGGLLITPVLEPGKTKVSGYFPAGTWYSLAGDSTIHSKGQWILLPAPLDTINVHVRA
GHILPLQEPAFSTTESRKKGMALVVALTLDGFARGDLFWDDGESWQTFERGDYTEILFLA
THGTVLSQLLQASAHLDGVLLEAVTVLGVTSPPRQVLANGVLVSDFSYRSDTQVLKVPVS
LPMWEQFVITWF
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggtacacgcacacgctccggtacacgtgtgcacaccggtacacgcgcacgcac
cggcccgcagcccgtgtccgcaggtggcagcgggcccggcccggggcgggggtgtccctg
cggtacccggccaggccacgctatgaggtgcccctggccgcgccgcgggtgggcggccgc
gctgccaccacgctctacggggtgcaggtcaaccaggatcccttcggccttgtcgtctac
cggcagcatggcgggcaggtcctggtcaacaccaccgtcgcaccactcttcttcgcagac
cagtttctgcagatctccacctccttgccctcccatttcatttctgggctgggggagcac
ctgacgccgctggtccttgacacggcgtggaccagggtcaccctctggaatcgggacatg
gcgcccacggcccaggtcaacctctatggctcccaccctttctacctggggatggaggac
ggtggtttggcccacggtgtctttctgctgaacagcaatgcgatggatgtgctgctgcag
cccagcccggccctgacctggcgcacgacaggcgggatcctggacttctatgtcttcctg
ggccccgaccccaagagcgtggtgcggcagtacttggatgttgttgggtttcccttcatg
cccccatactggggcttgggcttccacctctgccgctggggctactcctccaccgacatc
acccggcaggtcgtggacaacatgacagcagcccgctttcccctggacgtgcagtggaat
gacatggattacatggatgccaagagggatttcaccttcaacaagaaaagctttaaggac
tacccggagatggtgcgggacttccaccgtcgtgggctgaggtacatcatgatcgtggat
cctgggatcagcagctcggggcctcctggcacctacaagccctacgacgagggactgaag
cgaggggtgttcatccaaaatgccacggggcagcccctgattgggaaggtctggccgggc
ccgacggccttcccagattttaccaacccagagactcacgagtggtggcacgatatggtg
aaggacttccacaaccaagtgcccttcgatggcatgtggattgacatgaacgagccgtca
aacttcgtggaaggctcccaggatggctgccccaacaacagcctggagcagccaccctac
gtgccaggcgtgttcgggggacgcctgcaagccggcaccatctgtgcctccagccagcag
tacctgtcctcccactacaacctgcacagcctctacgggctgactgaggccatcgcctcc
cacgatgcgctgctgagggtcaggggcaagcgcccctttgtcatctcacgctcgacattt
gctgggcatgggcactacgcagggcactggacaggggacgtcagcagcaactgggagcag
ctctactactccataccagaggtgctgctcttcaacctctttggggtgccactggtgggt
gctgacatctgcggctttgtgggcaacacatccgaggagctgtgcgtgcgctggacccag
ctgggcgccttctaccccttcatgaggaatcacaatgaccatggtacccggccacaggag
ccgtacaccttcagcccggctgcccaggctgccatgaggaacgctctccgtctccgctac
tccctcctgcccttcctctacacccgcttccaccgggctcactctgctggggagacggtg
gcgcggcccctcttcctcgagttccccaaggaccccaacacctgggccgtggaccgccag
ctcatgtggggggggggcctgctcatcacacccgtgctggagccaggaaagaccaaagtc
agcggctacttcccagcggggacgtggtacagcctcgcaggggactccaccatccacagc
aaggggcagtggatcctcctgccagctcccctggacaccattaatgtccatgtccgtgca
ggacacatcctgcccttgcaggaacctgcattcagcaccactgagtcccgcaagaaaggg
atggccttggtcgtggcactgaccctggatggctttgccaggggagacctgttctgggac
gatggggagagctggcagacctttgagaggggggactacactgagatcctcttcctggcc
acacacggcactgtgctcagccagctcctgcaggcgagtgcccacctcgatggggtcctg
ctggaggctgtgaccgtgctgggcgtcaccagccctccccggcaagtcctggccaatggt
gtcctcgtgagcgacttctcctaccgcagcgacactcaggtgctgaaagtgcctgtgtcg
ctgccgatgtgggagcagtttgtgatcacttggttctga

DBGET integrated database retrieval system