KEGG   Falco peregrinus (peregrine falcon): 101918755Help
Entry
101918755         CDS       T02856                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00590  Arachidonic acid metabolism
fpg01100  Metabolic pathways
fpg04370  VEGF signaling pathway
fpg04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101918755 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101918755 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101918755 (PTGS2)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101918755 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 101918755
NCBI-ProteinID: XP_005242087
LinkDB All DBs
Position
Un
AA seq 603 aa AA seqDB search
MLLPCALVAALLATRPPANPCCSNPCQNRGVCMTTGLDQYECDCTRTGYYGENCTTPEFF
TWLRLTLKPLPNTVHYILTHFKGAWNIINDIPFLRDAIMRYVLTSRSHLIDSPPTYNSDY
SYKSWEAYSNLSYYTRSLPPVELDCPTPMGVKGKKELPDSKVLVEKFLLRKKFIPDPQGT
NVMFTFFAQHFTHQFFKTDHKKGPGFTKALGHGVDLNHIYGETLERQLKLRLLKDGKLKY
QMIDGEMYPPTVKDTQAEMIYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVCD
ILKQEHPEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGRV
AGGRNVPAAVQKVAKASIDQSRQMRYQSLNEYRKHFMLKPFKSFEELTGEKEMAAELEEL
YGDIDAMELYPGLLVEKPRPGAIFGETMVEIGAPFSLKGLMGNAICSPEYWKPSTFGGKV
GFEIINTASLQKLICNNVKGCPFTAFHILNPEPTEATINVSTSKRAMEDINPTLLLKERS
TEL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcccctgcgccctggtggccgcgctcctggctacccgcccccccgccaaccct
tgctgctccaacccctgtcagaacaggggcgtgtgcatgacaacaggactggatcagtac
gaatgtgactgcacgaggacaggatattatggggaaaactgtacaacaccggaattcttc
acgtggctgaggctaacattgaaacctttgccgaatactgtccactacatcctcacccac
ttcaaaggagcctggaatatcatcaatgacattccattcttaagagatgctattatgaga
tatgtattaacatcgagatcacacttgattgacagtccaccaacttacaatagtgattat
agttacaaaagctgggaagcttattccaatctttcctattacacaagaagccttccacca
gtagaacttgactgcccaacaccaatgggtgttaaaggtaagaaagagcttccagattcg
aaagtgcttgtggagaagtttttgctaaggaaaaaatttattcctgacccacaaggcaca
aatgtgatgttcacattctttgcccaacacttcactcatcagttctttaagacggaccac
aagaaaggacctggcttcaccaaagctctcggccatggggttgacttgaatcatatttac
ggagagactctggagagacaacttaaactgagacttctaaaagatggaaagctaaaatac
cagatgattgatggagaaatgtatccaccaacagtgaaggacactcaggcagagatgatc
taccctcctcacgtacctgaacacttgcagttttctgttgggcaggaggtgtttggtttg
gtcccgggcttgatgatgtatgctacaatatggctgagggaacacaaccgggtctgtgac
atcctgaaacaggagcatccagagtgggatgatgagcagctgttccaaactactagactc
atactgataggagaaacaatcaagattgttattgaggactatgtgcagcacttgagtggc
taccacttcaaactcaagtttgatcctgaactgctgttcaaccagcgatttcaataccag
aaccgaattgcagccgaattcaatactctctaccactggcacccgcttctgcctgacact
ttccagatacatgaccaggaatacactttccagcagttcctctacaacaactctataatg
ctggaacatggcctttcccatatggtgaagtctttctccaagcaaagtgctggcagggtt
gctggtgggagaaatgttcctgctgcagtacagaaagtagcaaaggcttcaattgaccaa
agcagacaaatgagataccagagcttgaatgagtacaggaaacacttcatgctgaaaccg
ttcaaatcatttgaagaacttacaggagaaaaagaaatggcagctgaactggaagagctt
tatggagacattgatgctatggagctgtacccaggtcttctcgtagaaaagccacgacca
ggtgccatcttcggtgaaacaatggtggagatcggagcaccattctctctgaaaggactg
atgggaaatgctatctgctcccctgagtactggaaacctagcaccttcggtgggaaagtg
ggcttcgaaataatcaatactgcctccttacagaagctcatctgcaacaacgtgaaaggc
tgccctttcactgctttccacatcttaaatcctgaacccacagaggcaactattaatgtt
agtacctcaaaaagagcaatggaagatatcaaccccacactactactgaaagagcgctct
actgagttgtaa

DBGET integrated database retrieval system