KEGG   Falco peregrinus (peregrine falcon): 101919117Help
Entry
101919117         CDS       T02856                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    101919117 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fpg01002]
    101919117 (TMPRSS2)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101919117 (TMPRSS2)
Peptidases [BR:fpg01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101919117 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2 Orf78
Motif
Other DBs
NCBI-GeneID: 101919117
NCBI-ProteinID: XP_005229570
LinkDB All DBs
Position
Un
AA seq 484 aa AA seqDB search
MTSTVSPQPYYENHGFQPENVYYARQTAGANPYPQYFSTNAPSVPSYVPRVATHQSSRPV
ARSSRRTCASSVKKTIVVILSILTVICCAIAAFFIWYFVENRCLGSLIECGSSGVCMPPS
QWCDGVSHCPNGEDETRCVRLFGPNFILQVYSPVSKSWYPVCQDDWNDDYGRIACKDMGY
SVDTYYYSRGVATEVGSKSYMKLNTSAGNIDLYKKLYSSDSCASGNVVSLRCVDCGLPTK
NVNIMNRIVGGSGAVPGQWPWQVSLHVHGTHVCGGSIITRQWIVTAAHCVEGRFSDPYSW
RVYAGILNQDEMLLRNGYRVQQIISHPDYDTDSKDNDVALMKLETLLSFTDTVRPVCLPN
PGMMFQPNQQCWISGWGAEYQGGKTSNSLNYVMVPLIEHSRCNSVSIYNGMILPTMICAG
YLGGGVDSCQGDSGGPLVTNKNSVWWLVGDTSWGTGCASPNRPGVYGNMTVFTDWIYKNM
QANR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacctctactgtaagtccacagccatactatgaaaatcatggctttcagccagaaaat
gtctattatgccaggcagacagccggtgctaacccgtatccacagtacttctcaacaaat
gctccgtcagtgccaagctatgtcccaagggttgctacccatcagtcgagtaggccagta
gcacgttcgtccaggagaacgtgtgcatcaagtgtaaagaaaaccatagttgtcatatta
tccattttaacagtcatttgttgtgcaattgctgctttcttcatctggtattttgtagag
aatcgttgtcttggctccttaatagagtgtggatcttcaggagtatgcatgccaccctcg
cagtggtgtgatggggtgagccactgccccaacggagaggatgaaacccgctgtgttaga
ctttttggaccaaactttatcctgcaagtttattcacctgtcagcaaatcctggtatcct
gtttgtcaagatgactggaatgatgattatgggaggattgcatgtaaagacatgggctac
agtgtggatacgtattactatagtcgaggagtagcaactgaagtcggctctaagagctac
atgaagctgaacacaagtgctgggaatatagacttgtacaaaaagctgtatagcagtgat
tcctgtgcatcaggaaatgtggtttctctgcgctgtgtagactgtggcctgcccactaag
aacgtgaacattatgaacagaattgtgggtggcagcggagcggtgccaggacagtggccg
tggcaggtcagcctccatgtgcatggcacccatgtttgcgggggctccatcatcacccgt
cagtggatagtgacagcggcgcactgcgtggaaggacgattttctgacccgtacagctgg
agggtttatgctgggattctgaatcaggatgagatgctcttaagaaacggatacagagtg
caacagataatttcccatccagattatgatacagattcgaaagacaatgatgttgccctt
atgaagttagaaacactgctgagttttactgatactgtacggccagtttgtctgcctaat
ccgggaatgatgttccagcctaatcagcagtgctggatatctgggtggggagcagagtac
caaggaggtaaaacatcaaatagcttaaattatgttatggtgcccttaatagaacattct
aggtgtaattctgtctctatctataatggcatgattttgcctacaatgatctgtgctgga
tatctaggaggaggagttgattcctgtcagggtgacagtggaggtccgctagtaactaac
aaaaactctgtgtggtggctggttggagataccagctggggaactggctgtgctagtccc
aatagacctggagtctatgggaatatgactgtgtttacagattggatttataaaaatatg
caggcaaacagatga

DBGET integrated database retrieval system