KEGG   Falco peregrinus (peregrine falcon): 101919573
Entry
101919573         CDS       T02856                                 

Gene name
ARRB1
Definition
(RefSeq) arrestin beta 1
  KO
K04439  beta-arrestin
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
fpg04144  Endocytosis
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101919573 (ARRB1)
   04340 Hedgehog signaling pathway
    101919573 (ARRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101919573 (ARRB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fpg04131]
    101919573 (ARRB1)
Membrane trafficking [BR:fpg04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    101919573 (ARRB1)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C LDB19 AP3B1_C
Other DBs
NCBI-GeneID: 101919573
NCBI-ProteinID: XP_013160589
LinkDB
Position
Un
AA seq 466 aa
MVKGSPVAAMEPSAAPSPLFCSIPRHHPCAESQQCRSRSPRVFKKASPNGKLCWHASLTP
PSLPQLTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCAFRYGREDLDVLG
LTFRKDLFVANAQAFPPVPEEKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPG
PEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPMAETTRQFLM
SDKPLHLEASLDKEIYYHGEPISVNVHVTNNTSKTVKKIKISVRQYADICLFNTAQYKCP
VAVEDADDMVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLRDGANK
EILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPAHRDVPENEAPI
DTNLIELDTNDDDIVFEDFARQRLKGMKDDKEDEEERTNSPQLNDR
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggtcaagggcagcccggttgcagccatggagccatctgccgccccatccccactcttc
tgcagcatcccacggcaccacccctgcgccgagtcccagcagtgccgcagcaggtccccg
cgggtgtttaagaaagccagtcccaacgggaagctgtgctggcacgcatccctgaccccg
ccatccctcccgcagctcaccgtctacctggggaagagggatttcgtggatcacattgat
gtggtggaccccgtggacggcgtggtgctggtggatcctgagtacctgaaggagagaaaa
gtctttgtgacgttgacctgcgccttccgctatggccgtgaggacctggatgtgctgggg
ctgactttccgcaaggacctcttcgtggccaacgcccaggccttccccccggtcccagag
gagaagaagcccctgacgcggctgcaggagcggctgatcaagaagctgggcgagcacgcc
taccccttcaccttcgagatcccccccaacctgccttgctccgtcacactgcagccgggt
ccggaggacacggggaaggcatgtggtgtggactatgaggtcaaagctttctgtgcagag
aacctggaggagaaaatccacaagaggaactcggtgcgcctggtgatccgtaaggtccag
tacgcaccagagcggcctggcccacagcccatggcggagaccacccggcagttcctcatg
tcggacaaaccgctgcacctcgaggcatccctggacaaggagatctactaccatggagag
ccgatcagcgtcaacgtccatgtcaccaacaacaccagcaagacggtaaagaagatcaag
atctcagtgcgccagtacgccgacatctgcctcttcaacactgcccagtacaagtgcccg
gtggccgtggaggacgctgatgacatggtggccccgagctcgacgttctgcaaagtctac
accctgacccccttcctcgccaacaaccgggagaagcgagggctggcactggatggcaag
ctcaagcacgaggacaccaacctggcatccagcacgctgttaagagatggagccaacaag
gagatcctgggcattatcgtctcctacaaggtgaaggtgaagctggtggtgtcacgagga
ggcctgctgggagacctcgcctccagcgatgttgcagtggagctgcccttcacgctgatg
catccaaaacctaaggaggaaccggcacaccgggacgttccagagaacgaagcacccata
gatacaaatctgatagagcttgacacaaatgacgacgacattgtgttcgaagactttgcc
cgccagcgactcaagggcatgaaggatgacaaagaggacgaggaggagcggacaaactcc
ccgcagctcaacgacagataa

DBGET integrated database retrieval system