KEGG   Falco peregrinus (peregrine falcon): 101919587
Entry
101919587         CDS       T02856                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
fpg  Falco peregrinus (peregrine falcon)
SSDB
Motif
Pfam: Nore1-SARAH RA Ras_bdg_2 Mst1_SARAH
Other DBs
NCBI-GeneID: 101919587
NCBI-ProteinID: XP_005235030
LinkDB
Position
Un
AA seq 296 aa
MHQPLPHQAPVPPPVQPRTLIPSAVVVTLFLSPSPDCSFICHYRCRALVRLDCSGPPSTS
DEDDGNEQALEKDTNVDEPSEWEKAELDQAQVEQRIKEYNSQINSNLFMSLNKDGSYTGF
IKVQLKLVRPVSVPATKRVPSLQAGRMGPHTQGVKRRTSFYLPKGTVKHLHILSHTRASE
VIDALLRKFTVVDNPHKFALFERSEKDEQVYLRKLADEEQPLRLRLLAGPSEKVLSFILK
ENETGEVNWDAFTLPELHNFLRILQREEEEHVRRLRHRYARCRQKMQEALATRPPG
NT seq 891 nt   +upstreamnt  +downstreamnt
atgcaccagcccttgccccaccaggcaccagtaccccccccggtgcagccacggaccctg
atacccagcgccgtggtggtgacactgttcctgtccccatccccagactgcagcttcatc
tgccactaccggtgccgggccttggtgcggctggactgcagcggccccccgagcaccagc
gatgaggacgatggcaacgagcaggcactggagaaggacaccaacgtggatgagcctagt
gagtgggagaaggcagagctggaccaggcacaggtggagcagcggatcaaggagtacaac
agccaaatcaacagcaacctcttcatgagcctgaacaaggatggctcctacactggcttt
atcaaggtgcagctgaagctggtgcgccctgtctcggtgccggccaccaagcgggtcccc
tccctgcaggcagggcggatggggccgcacacccagggggtgaagcgccgcacatccttc
tacctgcccaaggggactgtcaagcacctgcacatcctctcgcacacccgtgccagcgag
gtcatcgatgccctcctccgcaagttcaccgttgtggataacccccacaagttcgccctc
ttcgagaggtctgagaaggatgagcaagtgtacctgcggaagctggctgacgaggagcag
ccgctgcggctgcggctgctggctggccccagcgagaaggtgctcagtttcatcctgaag
gagaatgagactggggaggtgaattgggacgccttcacactgccggagctgcacaacttc
ctgcgcatcctgcagcgggaggaggaggagcacgtgcgccggctgcggcaccgctatgcc
cgctgccgccagaagatgcaagaggcactggccacccgcccaccagggtga

DBGET integrated database retrieval system