KEGG   Falco peregrinus (peregrine falcon): 101919762Help
Entry
101919762         CDS       T02856                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
fpg04210  Apoptosis
fpg04625  C-type lectin receptor signaling pathway
fpg04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101919762 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101919762 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101919762 (MAP3K14)
   04672 Intestinal immune network for IgA production
    101919762 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101919762 (MAP3K14)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101919762 (MAP3K14)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: STE group
  Other
   101919762 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 101919762
NCBI-ProteinID: XP_005234954
LinkDB All DBs
Position
Un
AA seq 948 aa AA seqDB search
MAVMGITCQGSPDPAVKHKKELTATKGLNESVSEKQSSVCKVEDSKKVIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDQIPNNV
AHATEGKMAPTCWRGRHRGKTKKKRHKKRSKLKVQTVAAGRRGPRTPEQESCTPIPVQED
ESHQNTLYRNRFWVSEFNKDLVYDPLPFEKPEKVLSTGKLHSPGSKYKAELHKLISPIQC
LNHVWKRHYQRDSVPQPETLHPFPXXXXXYNIIPPHFPHLDSPLPAMKRNALETYLHGDL
NYQDSEHRLSGLNLEYSFPKCINQSVKTSSDKISVEEYLVDALKGSVSLGEPQNLASLAK
TWRGGGLDLKEQFHEANENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIE
DKQTGFQCAAKKVQVEHFRAEELTTCAAVTSPKVVPLYGAVKEGPWVTIFMKLMEGGSLG
QLIKQSGCLPEDRALSYLGQALEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHS
AHLHPDGLGKSLVTGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQ
YYNHPLCLKIAKEPPPLREIPPSCNPLTAEIIKMGLEKEPVQRASASELKTKTSVALEEV
GGVTSPWKGEYREPRHLSLNKENNPQTSLSPTVSPVSETVSDPKLAVKVSCASAVLPLPP
LEQTEEVEGTPWNVCKELSETWDPPPLSSTPLLLKSCSHVEKATTISEQELQQLEIELFL
NSLSQPYSLEEQEQMLSCLSIDSPFVSDASEKNSMKASHSLRDTMSSGIHSWNSQADGQS
FSWNNLLKRNRHTDTPSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAF
SLVTKEGQSVHYDMEVPDSGIELQCTLAPDCSVSWTWRVKHGQLENRP
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattacatgccagggatctcctgatccagccgtcaagcacaagaag
gagctcacagctaccaaggggctgaacgagtcagtgagtgaaaagcagagcagtgtttgc
aaagtagaagattcgaagaaggtcatctttcacagccagtggaaaatcctgaatgatgta
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaggagttcagccccactttatcagagagatccttt
attgctcatagtaagcgttacagccggtcagacagtctcgatcaaatccctaacaatgtg
gcccatgcaacggagggaaagatggcacctacctgttggagagggaggcatcgtggcaag
acaaaaaagaaacgtcacaagaaaagatccaagctgaaagtacaaacagtggctgctggc
aggcgcggtcccagaactccagagcaagagagctgcaccccaattcctgtccaggaggat
gaatcacaccaaaatactctttacagaaaccgtttctgggtttcggaatttaacaaggac
ttggtctatgatccactgccatttgagaaacctgagaaagttctgtccacaggcaagctc
cattcaccagggagcaaatacaaagcagaactgcacaagttgataagccctattcagtgc
cttaatcatgtttggaaacggcactatcagagggacagtgttccacagcctgaaactctc
catccttttcccnnnnnnnnnnnnnnctacaacataataccccctcatttcccacatctg
gacagtcctctccctgccatgaaacgtaacgctctggagacgtacttgcatggtgatctc
aactatcaagacagtgagcatcgcttatctggcctaaacttagaatatagtttccccaaa
tgcatcaaccagtctgtgaaaaccagttcagacaagatttctgtggaagaatacttggta
gacgccttgaaggggagcgtgagtcttggtgaaccacaaaatttagccagcctagccaag
acgtggagaggaggtggtttggacctgaaggaacaatttcatgaagccaatgaaaatgaa
ggcgtgctacttaacgagaaactaaagccagtggattatgagtaccgagaagaggttcat
tggaccaagtgtcatggttctttgggcattggctcttttggagaagtatacaaaatagag
gataaacagacaggatttcagtgtgctgccaaaaaggtacaagttgaacacttccgtgca
gaagagttaacaacatgtgctgcagtaacgagtcctaaagttgtccccttgtacggagct
gtgaaggaaggaccttgggtgaccatcttcatgaagctgatggagggcggctcactaggt
cagctaattaaacagagcggctgcctgccagaggacagagccctcagttatttgggccag
gcattggagggcttggagtatcttcatgctcaaaacattctccatggagatgtaaaagcg
gaaaatgtgctcttgtctgatgatggaagcagggctcttctgtgtgactttggtcactct
gctcaccttcatccagatggcctgggaaagtccttggtcacagggaactatgtacctggc
acggagactcatatggctccagaggtggtgatgggaaagcgttgtgactccaaagtggat
gtctggagcagttgctgtatgatgctgcatatgcttaatgggtgccacccttggacccag
tattacaatcacccactctgtctgaagatagctaaagagccacctcctctgagggaaatt
ccaccttcctgcaaccctctgactgctgagattattaagatgggtctggagaaagagcct
gttcagagagcatctgcatctgaactgaaaactaagactagtgtcgcacttgaagaagtg
ggaggtgtgacaagcccctggaaaggcgaatacagagagcctaggcatttatctttgaac
aaagaaaacaatccacagacatccctgtcccccacagtcagcccagtttctgagactgtt
tctgacccaaaattggcagtcaaagtttcttgtgcaagcgcagtcctaccactgccacct
ctagagcaaaccgaggaggtcgagggaaccccttggaatgtgtgcaaggaattatcagag
acctgggatcctccacctctctcctcgactcctctccttttgaagagctgcagccatgtg
gagaaagcaacaaccatctcagaacaagagcttcagcagctggaaatagaactgtttttg
aacagcctttcacagccttactcgctggaagagcaagaacaaatgctttcatgtctcagc
atcgacagcccatttgtgtcagatgctagtgagaagaactccatgaaggcttctcatagc
ttgagggacactatgagctctggaattcattcctggaacagccaggcagatggacagagc
ttcagttggaacaatctgctgaaacgcaatcggcacacagacactcctagctatttcaac
ggagtgaaaatccagatccagttgctaagtggagaaaatttacacatcagggattttcat
aggacaaaggtgggagacattgccactgggataagcagccagataccagttcctgctttc
agtctggttactaaagaaggccagtcagttcactacgacatggaggtccccgactctggt
attgagctgcaatgcacccttgcccctgactgcagcgtcagctggacatggcgagtcaaa
catggtcagctggagaacagaccatga

DBGET integrated database retrieval system