KEGG   Falco peregrinus (peregrine falcon): 101919765Help
Entry
101919765         CDS       T02856                                 

Gene name
SI, MGAM
Definition
(RefSeq) sucrase-isomaltase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00052  Galactose metabolism
fpg00500  Starch and sucrose metabolism
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101919765 (SI)
   00500 Starch and sucrose metabolism
    101919765 (SI)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101919765 (SI)
    3.2.1.20  alpha-glucosidase
     101919765 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101919765
NCBI-ProteinID: XP_013153598
LinkDB All DBs
Position
Un
AA seq 1725 aa AA seqDB search
MGKRKFSGLEITLIVIVCLVTVIACVLIGLLASGESGVKTAEFSPECPNILIAERIDCIP
DQISTKLTCILRGCCWSPSSDTSVPWCFFPSNHGYKVDGSTRSTQAGFEATLTRLPSPSL
FGNDINTVLLTGEYQTPNRFRFKITDPKTQRFEVPHEHVQPFTGSAASNLNYKVDVKQNP
FGIVVTRISNGRVLFDTTIGPLQYADQFLQLSIKLPSSNIYGVGEHVHKQYRHDVNWKTW
PMFSSDVGTSGEMHNLYGVQTFFLCLEDSSGASFGVFLMNSNAMEFAVQPTPAVTYRTIG
GILDFYIFLGNTPEQVVQEYVKLVGLPALPSYWSLGFQLSRFGYGSLDEVKRVVERNRAI
GLPYDAQITDIDYMEEKKDFTYDKVKFQDLPYFASYMHDYGQKYIIILDPAISIKNLVNG
SSYESYVRGESKKVWVNESNGVTALLGEVWPGETVFPDFTNPDCTSWWVEECKLFYSIVP
YDGIWIDMNEVANFVKGSKNGCAQNDLNYPPFTPRILDNLMFSKTLCMDAVQKWGKHYDV
HNLYGYSMAISTQKVINTLFPGKRSFLISRSTFAGSGKHTGHWLGDNAATWDHIKWAIPG
MLDFNLFGIPYVGADICGFFDHTTEELCRRWMQVGAFYPFSRNHNSKDLIPQDPAVFGPD
SILVKSSKHYLNIRYTLLPYLYTLFYKAHTQGDTVVRPVLHEYQSVQFLWLILQFLKAAF
ILGHNLFVSLGQGPGTVESKAYIYYKFTVSNNVLQMDAINSNYTDPNNLKFEEIKILGAL
QEITAVTVSQKSVVESSLLNITYYPLEKVAHITGLQLELGKSYTITWTQQLSVNERFNCY
PSPDPTQEKCEQLGCAWEQVTSGLDIPPCYYNSSNAYSVDKIEYTSSGLAASLTLNSART
RANDNFTTPISTLRLEVKYHLNHMLQFKIYDYQNTRYEVPVPLNLPSSPTSTDTERLYEV
SVQKKPFGIQVWRKSTGTVIWDSQLPTFTFSDMFIQISTRLASQYIYGFGETEHNTFRHN
MSWHTWGMFTRDQPPTYKLNSYGYQPFYMALEEDGNAHGVLLLNSNAMDVTFQPTPALTY
RTTGGILDFYMVLGPTPELVVQEYTALIGRPVMPPYWSLGFHLCRYGYRNDSEIAQLVEG
MKAAGIPHDVQYADVDYMERQLDFTIGTRFAGLPALINRIKEEGMRFIIILDPAISGNET
NYPTFSRGLRNDVFIKWPNTDNIIYSKVWPFLPNVQINESLPEQTQIQIYGAHVAFPDFF
RNSTVGWWKNEILEFYNNPTNPSSSVKFDGLWIDMNEPAAFLNGAIGGCRNDLLNMPPYI
PDLGYRSDGLNVKTLCMEGQQHLPDGTPVRHYDVHNLYGWSQTKPTLDGLQSATKERGIV
ITRSTYPSSGKWAGHWLGDNTAAWDQLAKSVIGMMEFSLFGISYTGADICGFFKDSEYEL
CLRWMQLGAFYPYSRNHNQKGTRRQDPVSWNSTFEEVSRNVLNIRYTLLPYLYTLMYDAH
AHGSTVVRPMLHEFVEDRTTWEIYEQFLWGPALLISPVMQQNAVTVIAYLPNARWYDYYT
DEEIGFRGQFQILPAPLDHINLHIRGGYILAWQRPANTTFYSRKNPMGLTVALNDALFAE
GQLYWDDGVRIDAYEDSVYLLTSFTANQNVLNITVLHHGYTDPNNLTFTDIKVLGVPTSV
KQVTISQNGGMITSAHTANYYDAKKLLIITKLQLELGKNYTVQWS
NT seq 5178 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaggaagttcagtgggctggaaatcacactgatcgtcatcgtctgcctggtg
acagtcatagcctgtgtcctcattgggcttttagcatcaggagaatccggtgtcaaaact
gcagaattttcaccagaatgtccaaacatattaatagcagagagaattgactgcatccca
gatcaaatatcaacaaagctcacctgcatcctgcgtggctgctgctggagtcccagcagt
gataccagtgtgccctggtgttttttcccttcaaaccatgggtacaaagtggatgggtca
acaagatcaacacaggcaggattcgaggctacgttaacaaggctgccatcaccttccctc
tttggaaatgatatcaacactgttctcctcacaggagagtatcagacaccaaatcgcttc
cggttcaagatcactgatcctaaaacgcaaaggtttgaagtccctcatgagcatgtgcaa
cctttcactggatccgcagcctccaatttaaactacaaagtggatgtcaagcagaatcct
tttggcatcgtggtgaccaggataagcaacggtagagtgctatttgatactaccattgga
ccactgcagtacgctgaccagtttttacagctgtcgatcaaactacctagcagcaacatt
tacggtgtgggagagcacgtgcataagcaataccgacacgatgttaactggaaaacctgg
cccatgttcagcagtgatgttggcacctctggagaaatgcataacttatatggagttcaa
actttcttcttgtgcttggaagacagctccggagcctcctttggtgttttcctaatgaac
agtaatgccatggagtttgcagtgcagcccactccagcagtgacctacagaaccattggt
gggatccttgatttctatatcttcttggggaacactccagagcaagtagtccaggagtat
gtgaagcttgtgggactgccagcattgccatcctattggagcctgggcttccagctcagc
cgcttcggttatgggtctctggatgaggtgaagcgagttgtggagaggaacagggcgatt
gggctcccttatgatgctcagatcactgatattgactatatggaggaaaagaaagatttt
acatatgacaaagtgaagtttcaagatctcccttattttgcatcttatatgcatgactat
ggacaaaaatatattatcatattggatcctgctattagcataaaaaatctagtgaacggt
agttcatatgaaagctatgtcagaggagagagtaaaaaagtctgggttaatgaatcgaat
ggagtaacagcattacttggggaggtgtggccaggggaaactgtgttcccagacttcacc
aacccagactgcactagctggtgggtggaagaatgcaaactgttttatagcatagtgcca
tacgatgggatctggattgatatgaatgaagtagccaactttgttaaaggctcaaaaaat
ggttgtgcgcagaatgacttaaactatcctcctttcactccccgtattcttgataatctc
atgttttctaagacactttgtatggatgcagtacagaagtgggggaaacattatgatgtc
cacaatctttatggatattccatggccatatcaacacagaaagtcatcaatacactgttt
cctggaaaacgaagcttccttatttcacggtctacttttgctggatcaggaaagcacaca
ggacactggctgggagataatgcagcaacatgggatcacataaagtgggcgatacctgga
atgctggacttcaacctctttggaattccctatgttggagcagatatttgtggtttcttt
gaccacaccacagaagaactttgtagaagatggatgcaagtaggagcattttacccattc
tccaggaatcacaactctaaagatctcatacctcaggatccagctgtgtttggacctgat
tccatcttggtgaaaagctccaagcattacttgaacattcgctacactttgctgccctac
ctgtatacactcttctataaagctcatactcaaggagatacagttgtgcggccggttttg
catgaataccaaagtgtccagtttctctggcttatcctccagttcctaaaagctgccttt
atccttggtcacaatctatttgtttcacttgggcaggggccaggtacagttgagagtaaa
gcctacatttactacaagtttacagtttccaataatgttctacaaatggatgctataaac
agcaattatactgatccaaacaacctgaaatttgaagaaatcaagatactgggagcgctc
caggaaataacagcagttactgtatctcagaaaagtgttgtggaaagttctctgcttaat
atcacctattatcctttagaaaaggttgctcatataacaggacttcagcttgaactggga
aaatcttacacaataacatggactcaacaactgagtgtcaatgaaaggtttaattgttac
cccagtcctgacccaacacaagaaaaatgtgaacaacttggctgtgcttgggaacaagta
acatcaggcttggatattccaccctgctattacaactccagcaatgcttactctgtagac
aaaatagaatacacctcgtcaggtttggcagccagcctcaccttaaacagtgccaggacc
agggccaatgacaatttcactacaccgattagtacactacgcttggaggtgaaatatcat
ctcaaccacatgctgcaatttaagatttatgattatcaaaacacacgatatgaggttccg
gtaccactaaatctcccgagctccccaacaagcactgatacggaacgactctatgaagta
tcagttcagaaaaaaccatttggtatacaagtttggcgcaaaagcacaggaacagtcatc
tgggattcacagctgcccaccttcacgttcagtgacatgttcattcagatttctacccgc
ttagcatcccagtatatatatggatttggagaaactgagcacaatacatttcgacataac
atgagctggcatacctggggaatgttcacaagggaccagcctcctacttacaagttgaat
tcctatggttatcagccattttacatggctcttgaagaagatggcaatgcccatggagtt
cttttgcttaacagcaatgcaatggatgtgacattccagccaacccccgccctgacatat
cgcaccactggtggaattcttgacttctacatggttttgggcccaacgccagaacttgtt
gttcaggagtacactgcactgattggacgaccagtcatgccaccttactggtctttggga
ttccacttgtgccgctatggatacaggaatgactcagaaatcgcccagctggtggagggc
atgaaggcagctggaattccccatgatgtccaatatgcagatgttgactatatggaaagg
caactggacttcaccataggcacacgctttgctggattaccagctctgatcaacagaata
aaagaagaaggaatgcgatttataattatcctggatccagccatctctggaaatgaaacc
aattatcctactttctcaagaggtctgcggaatgatgtcttcataaaatggcccaatact
gataacattatatattccaaggtctggccatttcttcccaatgtacaaatcaatgagtca
ctgcctgagcaaacccaaatacagatctatggagcacatgttgctttcccagacttcttc
cgcaattccactgtggggtggtggaagaatgaaatcctggagttctacaacaatcccacc
aacccctccagcagtgtcaagtttgatggcttgtggattgacatgaatgaaccagcagct
tttctgaatggtgccattggcggatgtagaaatgacctcctaaatatgccaccatacata
cctgatttgggataccggtcagatggattaaatgtcaaaactctatgcatggaaggtcaa
caacatctgccagatggtaccccagttagacactatgatgtgcacaatctttatggatgg
tcacaaaccaaacctaccctggatggtttgcagagtgctaccaaggagcgtgggatcgtt
atcacccgttccacatatcccagtagtggaaaatgggcaggacactggcttggtgataac
actgcagcttgggatcagctagctaaatctgttatcggtatgatggagttcagtctcttt
ggaatatcttatacaggagctgatatctgtggcttcttcaaagactcggagtatgagctg
tgtcttcgctggatgcagctgggcgcgttttatccatattcgaggaatcacaatcagaaa
ggaacacggaggcaagatcctgtttcgtggaactcaacttttgaggaggtttccaggaat
gtgctgaatataagatataccctgttaccttatctgtacacgttaatgtatgatgcccat
gcccatggcagcactgtggtccgccccatgctccatgagtttgtagaagacagaaccacc
tgggaaatatatgagcaattcctttggggacctgcactgctcatcagccctgtgatgcaa
cagaatgctgtaacagtgattgcttacttacccaatgcccgctggtatgattactacaca
gatgaagagattggctttaggggacaattccaaattttaccagctcctttggaccatatc
aacctgcatatccgaggtggatacatccttgcttggcaaagacctgctaatacaactttt
tacagccgaaaaaacccgatgggactcactgtggctttgaatgacgccctgtttgcagaa
ggacagctttattgggatgatggggttcgcattgatgcatatgaagacagtgtatatctg
ctaacatcattcaccgctaatcagaatgttttaaatatcacggttttgcatcatggttac
actgatccaaacaacttaacgtttactgacattaaagtcctgggggtgcccaccagcgtt
aagcaggtgacaatatcacagaatggtgggatgatcacatcagctcacactgcaaactac
tatgatgccaagaagttgctgataatcacgaagcttcagcttgaattaggcaaaaactac
actgtgcaatggagctaa

DBGET integrated database retrieval system