KEGG   Falco peregrinus (peregrine falcon): 101920205
Entry
101920205         CDS       T02856                                 

Gene name
HHIP
Definition
(RefSeq) hedgehog interacting protein
  KO
K06231  hedgehog interacting protein
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101920205 (HHIP)
SSDB
Motif
Pfam: Folate_rec GSDH EGF_2
Other DBs
NCBI-GeneID: 101920205
NCBI-ProteinID: XP_005243380
LinkDB
Position
Un
AA seq 696 aa
MLKMLPFKLLLVAVVLCFFEGDAKFGESGARRRRCLNGTPPRRLKKRDRRVLSPEAPGGG
EAMCRGLYPRLSCCSRADAQGLLHAEAKILSVTNNTECAKLLEEIKCAHCSPHAQNLFHS
PEKGETPERELTLPYLCKDYCKEFYYTCRGHIPGFLQTTADEFCFYYARKDGGVCFPDFP
RKQVRGPASNSLDHMEEYDKEEEISRKHKHNCFCIQEVVSGLRQPVGAVHCGDGSHRLFI
LEKEGYVKIFSPEGDILKEPFLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYT
TNQERWAIGPHDHILRVVEYTVSRKNPHQVDMRTARVFLEVAELHRKHLGGQLLFGPDGF
LYIFLGDGMITLDDMEEMDGLSDFTGSVLRLDVNTDLCNVPYSIPRSNPHFNSTNQPPEI
FAHGLHNPGRCAVDRHPTDVNINLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFK
PFSSGSLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPATKQWQEKPLCLGNTGSCR
GFFSGPVLGFGEDELGEVYILSSSKSMTQPHSGKLYKIIDPKRPLVPEECKRTAQSAQIL
TSECSRHCRNGHCTPTGKCCCNQGWEGEFCRTAKCDPACRHGGVCVRPNKCLCKKGYLGP
QCEQVDRNIRRVTRAGILDQILDMTSYLLDLTSYIV
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgctcaagatgctgccgttcaagctgctgctggtggccgtggttctgtgcttcttcgag
ggggatgccaagtttggggagagcggcgcccggaggagaaggtgcctcaacgggaccccg
ccgaggcggctgaagaagcgcgaccggcgggtgctgtccccggaggccccgggcggcggg
gaggcgatgtgccgcggcctctacccccgcctgtcctgctgctcccgcgctgacgcgcag
gggctgctgcacgccgaggccaagatactttctgttaccaacaacacagaatgtgcgaag
ctactggaggaaatcaaatgtgcacactgctcacctcatgctcagaacctattccactca
cctgagaagggggaaacacccgagagagaactaactcttccctacctgtgcaaagactat
tgtaaagaattctattatacttgcagaggtcacataccaggttttctccaaactacagct
gatgagttttgcttttactatgcaagaaaagatggtggtgtatgctttccagattttcca
agaaaacaagtgcgagggccagcttctaactccctggaccacatggaagaatacgacaaa
gaggaagagatcagcagaaaacacaagcacaactgcttctgtattcaggaggttgtgagt
ggactaaggcagcctgtcggagcagtacattgcggggatggatcccatcgcctctttatt
cttgagaaagaaggatatgtgaagattttcagtcctgaaggagacatactcaaagaacct
tttctggatatacacaagctagttcaaagtggaataaagggaggagatgaaagaggactg
ttaagccttgcattccatcccaattacaagaaaaatggaaagctgtatgtgtcttatacc
accaaccaagaacggtgggctattggacctcatgaccacatccttagggtcgtagaatac
acagtgtccaggaaaaacccacaccaagttgatatgagaacagcaagagtgtttttagaa
gtagcagaactacatcgaaaacacctaggaggacagcttctgtttggcccagatggtttc
ctatacatttttcttggagatggcatgatcactctagatgatatggaggagatggatggt
ttaagtgattttacaggttctgtattacgccttgacgtaaatactgacctgtgcaacgtc
ccttattccataccacgcagcaacccacattttaatagcacaaaccagcctcccgagatt
tttgcacatggactccacaatccaggccgatgtgctgtggaccgccacccaacagatgta
aacatcaatttaactatactttgctcagattcaaatggaaagaacagatcttcagcacga
attttgcaaataataaagggtaaagactatgaaagtgagccttcacttttagaattcaaa
ccattcagcagtggatccttggttggtggatttgtctatcgaggctgccagtctgaaaga
ctttatggaagttatgtatttggagaccgcaacggaaattttttaacgctgcaacagagt
cctgcaaccaaacagtggcaagagaaacccctctgtcttggcaacactggttcatgtaga
ggtttcttttcaggccctgtcttgggatttggtgaagacgaattaggtgaggtttacata
ttatcaagcagtaaaagtatgacacagcctcacagtggaaaactctacaagatcattgac
ccaaaaaggcctttagtccctgaagaatgcaaaagaacagctcaatctgcacagatactg
acatctgagtgctccaggcattgtcggaatgggcactgcactcccacggggaaatgctgc
tgtaatcaaggctgggaaggagagttctgcagaactgcaaaatgtgacccagcctgtcga
catggaggtgtctgtgtaaggcctaataaatgcttgtgtaaaaaaggctatctcggcccc
cagtgtgaacaagtggatagaaacatccgaagagtgacaagggcaggtattcttgatcag
atcctagacatgacatcctatttgctggatctaaccagctatattgtatag

DBGET integrated database retrieval system