KEGG   Falco peregrinus (peregrine falcon): 101920907
Entry
101920907         CDS       T02856                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04060  Cytokine-cytokine receptor interaction
fpg04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101920907 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101920907 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fpg04052]
    101920907 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:fpg00536]
    101920907 (IL4)
Cytokines and growth factors [BR:fpg04052]
 Cytokines
  Interleukins
   101920907 (IL4)
Glycosaminoglycan binding proteins [BR:fpg00536]
 Heparan sulfate / Haparin
  Cytokines
   101920907 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 101920907
NCBI-ProteinID: XP_005242868
LinkDB
Position
Un
AA seq 135 aa
MIIPVPVLLILLALPACQGHVAARLQTSIFLKESIRLLNELLKTKVSCDNINMTNIFAGD
KEYDDMETLCKATTVAWEGRSCHRHLEGIYLNLLSLVQRKSPAHKAPCPVAAGNTTSLND
FLVDLRRVLQRLVKD
NT seq 408 nt   +upstreamnt  +downstreamnt
atgatcatcccggtcccagtcctgctcatcttgctggcgctgccagcctgccagggccac
gtggctgctcggctgcagacctccatctttctgaaggagagcatcaggctgctgaacgag
ctcctgaagacaaaggtttcctgtgacaacataaacatgacaaatattttcgcaggcgat
aaggaatacgatgacatggagaccttatgcaaagccaccacagtagcctgggagggccgg
agctgccacaggcacctggagggcatttacctcaacttgctcagtctggtccaaaggaag
agcccagcccacaaggcaccatgtcccgtggcagccggcaacactacctccctgaatgac
ttcctagtggacttacgcagagtcctccaacgactagtaaaagactag

DBGET integrated database retrieval system