KEGG   Falco peregrinus (peregrine falcon): 101921077
Entry
101921077         CDS       T02856                                 

Gene name
KIF3A
Definition
(RefSeq) kinesin family member 3A
  KO
K10394  kinesin family member 3A
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101921077 (KIF3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fpg04812]
    101921077 (KIF3A)
Cytoskeleton proteins [BR:fpg04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     101921077 (KIF3A)
SSDB
Motif
Pfam: Kinesin Microtub_bd DUF812
Other DBs
NCBI-GeneID: 101921077
NCBI-ProteinID: XP_013158999
LinkDB
Position
Un
AA seq 594 aa
MEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKAQTQRL
EVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIE
CSEKGVDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVD
GKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKA
RINEDPKDALLRQFQKEIEELKKKLEEGEEISGSESSDSEEEDEDDDGEIGDDGEKRKKR
RDQAGKKKVSPDKMVEMQAKIEEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEH
QSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRKELEEKEQER
LDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSREL
RLQMLIIDNFIPQDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVLDKKEKDPFE
VDLSHVYLAYTEESLRQSLMKLERPRTSKGRSRPKTGRRKHSAKPGAVIDSLLQ
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggaaggggtccgagcagttcctgagcttagaggcatcattcccaattcctttgctcat
atatttggtcacattgccaaggcagagggggatacaaggtttttagttcgtgtgtcttac
ctggaaatttacaatgaagaagtgcgggacctgctagggaaagcccagacacagagatta
gaggttaaagagagacctgatgtgggagtttatatcaaagacctttcagcttatgtcgta
aacaatgcagacgatatggacagaatcatgactctgggccacaagaaccgttctgttggt
gccacaaacatgaatgaacacagctctcgttcgcacgccatcttcactatcactattgag
tgcagtgagaagggggttgatggaaacatgcatgtgcgcatgggcaaactgcacctcgtt
gatcttgctggttctgaaaggcaggcgaaaactggagccacagggcagcgactgaaggaa
gctactaagatcaacctctctctttcgacgctggggaatgttatctctgcgctggtggat
ggcaagagcacccacgtgccctaccgtaactccaaacttacacggctccttcaggattct
ctggggggcaactccaaaaccatgatgtgtgcaaacattggaccagcagactataactac
gatgagactatcagcactctcaggtatgcaaaccgagccaagaatataaagaacaaggcc
aggattaatgaagaccccaaggatgctttgctccgccagtttcagaaagaaattgaagag
cttaagaaaaaactggaagaaggggaagagatatctggttcagagagcagtgattctgaa
gaggaggatgaagatgatgatggggagattggagacgatggggagaagcggaagaaacgg
cgggatcaagcaggcaaaaagaaagtttcccctgataagatggtagagatgcaagcaaag
attgaagaggagagaaaagctcttgaaactaagcttgatatggaagaagaagaaagaaac
aaagccagagctgaactggagaaaagggaaaaagatttgcttaaagctcaacaagagcac
cagtccctgttggagaagctgtctgcattggagaagaaggtaattgtgggaggagtagac
ttgctggcaaaagcagaggagcaagagaagcttctagaagaatctaatatggaactggaa
gaacgaaggaagagagcggaacagcttcgcaaggagcttgaggagaaagagcaagaacgc
ttggacatcgaggagaagtacacaagcctccaggaggaagcacaggggaaaaccaaaaag
ctgaagaaagtttggacaatgcttatggctgcaaaatcagagatggcagatctgcaacaa
gagcatcagagagaaattgaaggattactagagaatattcggcagctgagcagggaactt
cgtctgcagatgcttatcatagacaacttcattcctcaggactaccaggaaatgattgaa
aactacgttcactggaatgaagacattggagaatggcagctgaaatgtgttgcatatacg
ggaaacaatatgaggaaacagacacctgtcttggataaaaaagagaaagatccctttgaa
gtggacctttcccatgtttacttagcttacactgaagaaagcttgaggcaatctctgatg
aagctggagaggccaaggacttcaaaaggaagatccaggcccaagacgggtagaagaaaa
cactcagcaaagccaggagccgtcattgactctctgctgcagtag

DBGET integrated database retrieval system